BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0082 (430 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 8.7 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 20.6 bits (41), Expect = 6.6 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 11 ARPLHPPRHDRAPRRLLAFTKSRLTSSSSAIVVI 112 A+PL R+ R PR+ L F T ++ +++ Sbjct: 274 AKPLTQIRNIRGPRKRLRFAYVTRTGANIKKLIV 307 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 8.7 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 338 PRICGPALHGEPVCATDGYIYPSLCKMRKK 427 P+ C P LH P + Y C RK+ Sbjct: 1231 PQNCAPGLHYNPEEHMCDWKYKVKCVGRKQ 1260 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,379 Number of Sequences: 336 Number of extensions: 1171 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -