BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0082 (430 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.003 SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) 36 0.014 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) 35 0.025 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.076 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.13 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.54 SB_7030| Best HMM Match : Kazal_2 (HMM E-Value=4.6e-08) 31 0.54 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 30 0.94 SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) 30 0.94 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 1.2 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 29 1.2 SB_15403| Best HMM Match : CH (HMM E-Value=0) 29 1.2 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 1.6 SB_9563| Best HMM Match : Kazal_1 (HMM E-Value=1.7e-07) 29 1.6 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 1.6 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 29 2.2 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_27871| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 28 2.9 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 28 3.8 SB_13198| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 5.0 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_20440| Best HMM Match : SRP-alpha_N (HMM E-Value=1.4) 27 8.7 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 27 8.7 SB_11598| Best HMM Match : Kazal_2 (HMM E-Value=2.1e-05) 27 8.7 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CP C PA + VCA+DG YPS+C+M + Sbjct: 3002 CPPGCPPAEVSQRVCASDGLTYPSVCEMHR 3031 Score = 34.3 bits (75), Expect = 0.044 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CP+IC L +PVCA+D YP+ C M++ Sbjct: 1580 CPKICPITL--DPVCASDNNTYPNECAMKQ 1607 Score = 32.3 bits (70), Expect = 0.18 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 CP C P L PVC +DG Y S C M +K Sbjct: 2625 CPPACKPTL--TPVCGSDGVTYESECGMIQK 2653 Score = 30.3 bits (65), Expect = 0.71 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 SCP C +P+CA+DG Y + C M+K+ Sbjct: 2153 SCPDDC--TNETKPICASDGQTYDNECLMQKR 2182 Score = 29.9 bits (64), Expect = 0.94 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMR 421 SCP CG +P+C ++ Y + C++R Sbjct: 288 SCPSSCGDESLPQPICGSNNKTYANECELR 317 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 +CP C + +PVC TD Y + C MR++ Sbjct: 1134 ACPENCSSTV--DPVCGTDNNTYDNECLMRQQ 1163 Score = 28.7 bits (61), Expect = 2.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 368 EPVCATDGYIYPSLCKMRKK 427 +PVC +D YP+ C+MR++ Sbjct: 617 DPVCGSDSKTYPNECRMRQE 636 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 +CP C + +PVC +D Y + C MR++ Sbjct: 1205 ACPENCSSTV--DPVCGSDNNTYDNECLMRQQ 1234 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 371 PVCATDGYIYPSLCKMRK 424 PVC DG +P+ C+MR+ Sbjct: 1006 PVCTNDGKKFPNECQMRQ 1023 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 314 EASRDASCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 E SCP C P+ G+PVC +DG Y S C++RK+ Sbjct: 1675 EGGIKCSCPIYCPPS--GQPVCGSDGKSYGSECELRKE 1710 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 311 SEASRDASCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 S A+ CP C P+ +PVC DG Y +LC + ++ Sbjct: 571 SSANASCICPTNC-PS-DWDPVCGDDGVTYQNLCHLLRE 607 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 311 SEASRDASCPRICGPALHGEPVCATDGYIYPSLCKMR 421 ++ S CP P PVC +DG Y + CK+R Sbjct: 500 ADGSTTCQCPTDRCPK-EASPVCGSDGKTYENECKLR 535 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 314 EASRDASCPRICGPALHGEPVCATDGYIYPSLCKMR 421 + S CP+ PVC TD YPS C M+ Sbjct: 354 DGSMKCVCPKPEECPYVNAPVCGTDDRTYPSECIMK 389 >SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) Length = 54 Score = 35.9 bits (79), Expect = 0.014 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +2 Query: 341 RICGPALHGEPVCATDGYIYPSLCKMR 421 R CG PVC TDG YPS CK+R Sbjct: 3 RPCGDEKEAFPVCGTDGNDYPSRCKLR 29 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 35.5 bits (78), Expect = 0.019 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 320 SRDASCPRICGPALHGEPVCATDGYIYPSLCKMR 421 S CP IC LH PVC +DG +Y + C MR Sbjct: 1362 SAQCVCPSIC--PLHYSPVCGSDGNMYSNECAMR 1393 Score = 34.3 bits (75), Expect = 0.044 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 335 CPRICGPALHG-EPVCATDGYIYPSLCKM 418 CP+ C PA +G E +C TDG YPS C+M Sbjct: 52 CPQGC-PAPNGDETICGTDGISYPSPCEM 79 Score = 33.9 bits (74), Expect = 0.058 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 338 PRICGPALHGEPVCATDGYIYPSLCKMRK 424 P IC P + PVC +DG IY C++RK Sbjct: 1756 PSICSPVI--SPVCGSDGKIYKDDCELRK 1782 Score = 30.7 bits (66), Expect = 0.54 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 314 EASRDASCPRICGPALHGEPVCATDGYIYPSLCKMR 421 + S CP C PVC TDG Y + C+MR Sbjct: 1288 DGSTSCKCPIFC--TYEYMPVCGTDGKTYGNKCEMR 1321 Score = 29.9 bits (64), Expect = 0.94 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 371 PVCATDGYIYPSLCKM 418 PVCA+DG YP++C M Sbjct: 1823 PVCASDGQTYPNVCTM 1838 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 359 LHGEPVCATDGYIYPSLCKM 418 L PVCA+DG IYP+ M Sbjct: 1975 LEYRPVCASDGKIYPNRMTM 1994 >SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) Length = 502 Score = 35.1 bits (77), Expect = 0.025 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 365 GEPVCATDGYIYPSLCKMRK 424 G PVCA DG IY +LCKMR+ Sbjct: 415 GVPVCADDGLIYGNLCKMRQ 434 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 33.5 bits (73), Expect = 0.076 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CP C P EPVC DG Y +LC++RK Sbjct: 4237 CPSRCLP--DKEPVCGADGKTYRNLCEIRK 4264 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 33.1 bits (72), Expect = 0.10 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 326 DASCPRICGPALHGEPVCATDGYIYPSLCKMRK 424 + C C PA + +CA+DG Y S C++ K Sbjct: 46 ECRCTSTCSPAQPSDRLCASDGITYNSKCELNK 78 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 32.7 bits (71), Expect = 0.13 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 344 ICGPALHGE--PVCATDGYIYPSLCKMRKK 427 +C P E PVC TDG Y +LC +R K Sbjct: 597 VCPPGCPSEVKPVCGTDGVTYDNLCSLRLK 626 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMR 421 CPR C L PVC +DG Y + C MR Sbjct: 1068 CPRRCPKKLM--PVCGSDGKTYNNECLMR 1094 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 31.1 bits (67), Expect = 0.41 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 317 ASRDASCPRICGPALHGEPVCATDGYIYPSLCKMRK 424 A ASC + H +PVC +DG YP+ C++ + Sbjct: 73 AKGKASCECLSECPDHIKPVCGSDGVTYPNHCELHR 108 >SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 30.7 bits (66), Expect = 0.54 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CPR C P+ + + VCAT+G + +LC+++K Sbjct: 326 CPRKC-PS-YVDQVCATNGETFDNLCRLKK 353 >SB_7030| Best HMM Match : Kazal_2 (HMM E-Value=4.6e-08) Length = 286 Score = 30.7 bits (66), Expect = 0.54 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CPR C P+ + + VCAT+G + +LC+++K Sbjct: 60 CPRKC-PS-YVDQVCATNGETFDNLCRLKK 87 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 29.9 bits (64), Expect = 0.94 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRK 424 SCP IC P+C +DG Y + C+M + Sbjct: 5153 SCPDIC--TFEYSPLCGSDGKTYDNQCEMER 5181 >SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) Length = 982 Score = 29.9 bits (64), Expect = 0.94 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 421 PHLAERGVDVPVGGADGLPVQRRPANARTRSVARCLARRREDKEGSSGEEV 269 P +G D+ D L P + R R R ++R+D + SSGE++ Sbjct: 677 PEFEFKGEDIESDDDDALEAAVVPTSQRRRRSTRIKRQQRQDSDESSGEDL 727 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 +CP C + +PVC TD Y + C MR++ Sbjct: 160 ACPENCSSTV--DPVCGTDNNTYDNECLMRQQ 189 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 +CP C + +PVC +D Y + C MR++ Sbjct: 274 ACPENCSSTV--DPVCGSDNNTYDNECLMRQQ 303 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 371 PVCATDGYIYPSLCKMRK 424 PVC DG +P+ C+MR+ Sbjct: 32 PVCTNDGKKFPNECQMRQ 49 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 +CP C + +PVC TD Y + C MR++ Sbjct: 26 ACPENCSSTV--DPVCGTDNNTYDNECLMRQQ 55 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 332 SCPRICGPALHGEPVCATDGYIYPSLCKMRKKT 430 +CP L VC TDG Y +LC++R ++ Sbjct: 1306 TCPDPAACPLVKSRVCGTDGITYDNLCRLRAES 1338 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 314 EASRDASCPRICGPALHGE--PVCATDGYIYPSLC 412 +A D +C A E PVC +DG Y +LC Sbjct: 713 QAGADGKTKCVCSAACTREYAPVCGSDGNTYNNLC 747 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 29.1 bits (62), Expect = 1.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKM 418 CP++C L PVC +D Y +LC + Sbjct: 196 CPKVC--TLDYTPVCGSDNKTYANLCNL 221 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLC 412 CP+ C +P C TDG YP+ C Sbjct: 279 CPKAC--TREYKPACGTDGNTYPNRC 302 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CPR C L PVC TD Y ++C + + Sbjct: 118 CPRACTRELM--PVCGTDQKTYDNMCLLER 145 >SB_9563| Best HMM Match : Kazal_1 (HMM E-Value=1.7e-07) Length = 170 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CPR C P+ + + VCAT+G + +LC ++K Sbjct: 103 CPRKC-PS-YVDQVCATNGETFDNLCLLKK 130 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRK 424 CPR C + +PVC TDG Y + C +R+ Sbjct: 733 CPRQC--QVRFKPVCGTDGREYLNRCFLRR 760 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 28.7 bits (61), Expect = 2.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +2 Query: 329 ASCPRICGPALHGEPVCATDGYIYPSLCKMRKK 427 A+C C H PVC +D Y + C + ++ Sbjct: 6 ANCSFSCDDGFHQTPVCGSDDVTYANACTLDER 38 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 28.7 bits (61), Expect = 2.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 368 EPVCATDGYIYPSLCKM 418 EPVC TDG +P+LC + Sbjct: 190 EPVCDTDGQQHPNLCSL 206 >SB_27871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 28.7 bits (61), Expect = 2.2 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -1 Query: 427 LLPHLAERGVDVPVGGADGLPVQRRPANARTRS 329 LLP A +G PV A PVQ RPAN RS Sbjct: 672 LLPKQAAQGKGGPVMNASSKPVQ-RPANVNRRS 703 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 28.3 bits (60), Expect = 2.9 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 368 EPVCATDGYIYPSLCKMRK 424 +PVC +DG Y ++CK+R+ Sbjct: 282 DPVCGSDGKNYDNVCKLRQ 300 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 332 SCPRICGPALHGEPV-CATDGYIYPSLC 412 SCP++CGP G PV C +D I P+ C Sbjct: 1723 SCPKVCGP---GCPVQCCSDLNICPANC 1747 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRKKT 430 C R C PA++ +PVC TDG Y + C + T Sbjct: 24 CVRPC-PAIN-DPVCGTDGKTYGNECMLGAAT 53 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMR 421 CP C PVC +DG YP+ C M+ Sbjct: 47 CPMAC--TREYAPVCGSDGKTYPTECVMQ 73 >SB_13198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 379 ADGLPVQRRPANARTRSVA---RCLARRREDKEGS 284 AD P RR +N+R R+++ R L+RRR G+ Sbjct: 148 ADAEPSSRRRSNSRRRTISTRRRSLSRRRRSSSGA 182 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 RPLHPPRHDRAPRRLLAFTKSRLTSS 91 RP+ PPR RAP +A TK+ + S+ Sbjct: 2543 RPIQPPRLSRAPSVRMANTKAPMIST 2568 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCKMRKKT 430 C R C PA++ PVC TDG Y + C + T Sbjct: 44 CVRPC-PAIY-MPVCGTDGKTYGNKCMLGAAT 73 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 347 CGPALHGEPVCATDGYIYPSLCKMRKKT 430 C + VC DG Y SLC++R T Sbjct: 134 CNSSPADTEVCGADGVTYGSLCRLRVAT 161 >SB_20440| Best HMM Match : SRP-alpha_N (HMM E-Value=1.4) Length = 526 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 104 VVIFEAACWLS-SCIAQHVPQEVSEDNSARLVLLRYSQKTHLLDRDQ 241 V IFE W C A+ E ++N + LVL+ + + H+ ++ Sbjct: 92 VEIFEQLVWRKYKCTARQGRAETGQENVSHLVLMSFRIRLHVTRHEE 138 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 320 SRDASCPRI--CGPALHGEPVCATDGYIYPSLCK 415 SRD C C A+ GEP+CA Y LC+ Sbjct: 494 SRDCECHHNAPCHYAVSGEPICACPLGTYGRLCE 527 >SB_11598| Best HMM Match : Kazal_2 (HMM E-Value=2.1e-05) Length = 79 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 335 CPRICGPALHGEPVCATDGYIYPSLCK 415 CP+ C ++ E CA DG Y ++C+ Sbjct: 34 CPKSC--PVYQEEYCANDGKTYSNMCE 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,820,513 Number of Sequences: 59808 Number of extensions: 166938 Number of successful extensions: 655 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -