BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0078 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 290 7e-79 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 290 7e-79 SB_56| Best HMM Match : Actin (HMM E-Value=0) 290 7e-79 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 290 9e-79 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 288 3e-78 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 288 4e-78 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 258 3e-69 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_54| Best HMM Match : Actin (HMM E-Value=0) 87 1e-17 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 85 4e-17 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 4e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.007 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.027 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 33 0.25 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 32 0.44 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.3 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 4.1 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 29 4.1 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 7.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 28 9.5 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 9.5 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 28 9.5 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 290 bits (712), Expect = 7e-79 Identities = 134/140 (95%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 199 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 258 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 259 NTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 318 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGP+IVHRKCF Sbjct: 319 WISKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 290 bits (712), Expect = 7e-79 Identities = 134/140 (95%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 297 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGPSIVHRKCF Sbjct: 357 WISKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 290 bits (712), Expect = 7e-79 Identities = 134/140 (95%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 296 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGPSIVHRKCF Sbjct: 356 WISKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 290 bits (711), Expect = 9e-79 Identities = 134/140 (95%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 297 NTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGPSIVHRKCF Sbjct: 357 WISKQEYDESGPSIVHRKCF 376 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 288 bits (707), Expect = 3e-78 Identities = 133/140 (95%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 296 NTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGPSIVHRKCF Sbjct: 356 WISKQEYDESGPSIVHRKCF 375 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 288 bits (706), Expect = 4e-78 Identities = 132/140 (94%), Positives = 138/140 (98%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 +EKSYELPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA Sbjct: 210 IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYA 269 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 332 NTV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM Sbjct: 270 NTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 329 Query: 331 WISKQEYDESGPSIVHRKCF 272 WISKQEYDESGP+IVHRKCF Sbjct: 330 WISKQEYDESGPAIVHRKCF 349 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 258 bits (633), Expect = 3e-69 Identities = 117/142 (82%), Positives = 130/142 (91%) Frame = -3 Query: 697 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 518 P LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDL Sbjct: 8 PILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDL 67 Query: 517 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 338 Y+N VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQ Sbjct: 68 YSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQ 127 Query: 337 QMWISKQEYDESGPSIVHRKCF 272 QMWI+K+EY E GP IVHRKCF Sbjct: 128 QMWIAKEEYHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 99 bits (238), Expect = 2e-21 Identities = 59/160 (36%), Positives = 87/160 (54%), Gaps = 29/160 (18%) Frame = -3 Query: 691 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 512 L + Y LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299 Query: 511 NTVLSGGTTMYPGIADRMQKEITAL---------------------APST-----MKIKI 410 + VLSGG+TMYPG+ R+++EI L P T K KI Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKI 359 Query: 409 -IAPP-ERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 299 I P RK+ V++GG++LA + W++++EY+E G Sbjct: 360 RIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 87.4 bits (207), Expect = 1e-17 Identities = 41/73 (56%), Positives = 49/73 (67%) Frame = -3 Query: 712 ELGTGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVD 533 E T E Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D Sbjct: 2274 EAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDID 2333 Query: 532 IRKDLYANTVLSG 494 +R +L+ N VLSG Sbjct: 2334 LRAELFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.4 bits (202), Expect = 4e-17 Identities = 50/149 (33%), Positives = 75/149 (50%), Gaps = 17/149 (11%) Frame = -3 Query: 655 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 479 + + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 478 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 347 R+Q++I + P ++ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 346 TFQQMWISKQEYDESGPSIVHRKCF*THR 260 F + +K +YDE GPSI F HR Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF-LHR 343 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 68.9 bits (161), Expect = 4e-12 Identities = 30/85 (35%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -3 Query: 595 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 416 G A G+ + S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 415 KII---APPERKYSVWIGGSILASL 350 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 52.4 bits (120), Expect = 4e-07 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = -3 Query: 559 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 404 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 403 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDE 305 PP + W+GG+I SL +++ Y + Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -3 Query: 556 SIMKCDVDIRKDLYANTVLSGGTTMYPG 473 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +3 Query: 708 NSPYSESITIHWPSFYN 758 NSPY ITIHWPSFYN Sbjct: 75 NSPYMSRITIHWPSFYN 91 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 703 TGPPLEKSYELPDGQVITIGNERFRCPEALFQPSFL 596 T L K Y LPDGQ+I+IG E E LF+P L Sbjct: 863 TNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 696 GPVPNSPYSESITIHWPSFYN 758 G P P ITIHWPSFYN Sbjct: 38 GGAPIRPIVSHITIHWPSFYN 58 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 32.3 bits (70), Expect = 0.44 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +3 Query: 663 PSGSS*DFSRG--GPVPNSPYSESITIHWPSFYN 758 P GSS + G P P ITIHWP+FYN Sbjct: 23 PGGSSCSRAAATDGGAPIRPIVSRITIHWPAFYN 56 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 625 PEALFQPSFLGMEACGIHET 566 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 363 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 536 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 537 TS 542 S Sbjct: 815 AS 816 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 657 SSPSETKDSVAQRLSSNPRSWVWK 586 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 663 PSGSS*DFSRGGPVPNS--PYSESITIHWPSFY 755 P GS+ + G V + P ITIHWPSFY Sbjct: 1 PGGSTSSIAAGIAVELAIRPIVSRITIHWPSFY 33 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 390 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 271 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 729 ITIHWPSFYN 758 ITIHWPSFYN Sbjct: 4 ITIHWPSFYN 13 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -1 Query: 348 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 238 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 511 NTVLSGGTTMYPGIADRMQKEITALAP 431 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 345 PSNKCGSRNKSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 226 P N+ G++ + +L P++TGS + RT + P+A C Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 750 TTASEL*STHYRANWVPGPPSRSLTNFPTVRSSPSETKDSVAQR 619 T +S+L T + VPGPPSRS + + +S S V +R Sbjct: 5 TPSSKLTLTKGNKSLVPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 7.2 Identities = 26/74 (35%), Positives = 34/74 (45%), Gaps = 11/74 (14%) Frame = +2 Query: 569 LVDAASFHTQERGLEESLWATESFVSDGDDLTVGKFVRLLEGGPGT-----------QFA 715 L+ + + Q RGLE S A ++ D + F+ L+ G T QFA Sbjct: 34 LIAYKTINLQRRGLEASASAHKTAKLDYQNKVEKYFIEFLQPGGSTSSRAAATAVELQFA 93 Query: 716 L**VDYNSLAVVLQ 757 L YNSLAVVLQ Sbjct: 94 LYESYYNSLAVVLQ 107 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 372 VDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSA-SKRTA 259 VD+S P SLP+ K G + S P GS+ SK TA Sbjct: 1939 VDKSEPGSLPTVKFGVTTTADASSMPKFQFGSSGSKDTA 1977 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 657 SSPSETKDSVAQRLSSNPRSWVWK 586 S+ SETK SV +R + + W+W+ Sbjct: 457 STKSETKASVVERFNRTFKGWMWR 480 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 657 SSPSETKDSVAQRLSSNPRSWVWK 586 S+ SETK SV +R + + W+W+ Sbjct: 93 STKSETKASVVERFNRTFKGWMWR 116 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 750 TTASEL*STHYRANWVPGPPSRSLTNFPTVRSSPSETKDSVAQR 619 T +S+L T VPGPPSRS + + +S S V +R Sbjct: 5 TPSSKLTLTKGNKTLVPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 750 TTASEL*STHYRANWVPGPPSRSLTNFPTVRSSPSETKDSVAQR 619 T +S+L T VPGPPSRS + + +S S V +R Sbjct: 5 TPSSKLTLTKGNKTLVPGPPSRSTVSISLISNSCSPGDPLVLER 48 >SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 657 SSPSETKDSVAQRLSSNPRSWVWK 586 S+ SETK SV +R + + W+W+ Sbjct: 439 STKSETKASVVERFNRTFKGWMWR 462 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 750 TTASEL*STHYRANWVPGPPSRSLTNFPTVRSSPSETKDSVAQR 619 T +S+L T VPGPPSRS + + +S S V +R Sbjct: 5 TPSSKLTLTKGNRKLVPGPPSRSTVSISLISNSCSPGDPLVLER 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,403,005 Number of Sequences: 59808 Number of extensions: 563677 Number of successful extensions: 3970 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 3735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3958 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -