BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0076 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40510| Best HMM Match : Y_phosphatase (HMM E-Value=0) 65 5e-11 SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_25734| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_30129| Best HMM Match : Y_phosphatase (HMM E-Value=6.7e-13) 55 4e-08 SB_25091| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) 55 6e-08 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 54 8e-08 SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) 53 2e-07 SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) 47 2e-05 SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) 46 3e-05 SB_12732| Best HMM Match : Y_phosphatase (HMM E-Value=0) 43 2e-04 SB_47814| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54099| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) 39 0.003 SB_52620| Best HMM Match : Y_phosphatase (HMM E-Value=9.3e-06) 39 0.003 SB_50464| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) 39 0.003 SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) 39 0.003 SB_47501| Best HMM Match : Y_phosphatase (HMM E-Value=9e-12) 37 0.016 SB_21229| Best HMM Match : Y_phosphatase (HMM E-Value=0) 36 0.028 SB_40495| Best HMM Match : Y_phosphatase (HMM E-Value=2.8e-06) 34 0.11 SB_30310| Best HMM Match : Y_phosphatase (HMM E-Value=0) 30 1.4 SB_34699| Best HMM Match : Peptidase_S8 (HMM E-Value=1.5e-07) 29 2.4 SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 28 7.5 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50357| Best HMM Match : Toxin_8 (HMM E-Value=2.4) 27 9.9 SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) 27 9.9 >SB_40510| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 734 Score = 64.9 bits (151), Expect = 5e-11 Identities = 32/78 (41%), Positives = 47/78 (60%) Frame = +2 Query: 11 LVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVR 190 L+ L+N ++ +Q++ + V DG R+G CA + IE+V VDVFQAVK +R Sbjct: 639 LLPLLNDIQTSQQKSGDKSIVVQCSDGVGRSGTLCAIMSVIERVKVEHVVDVFQAVKNLR 698 Query: 191 RHRPQLVENMTEYKYCYD 244 RP VE + +YK+CYD Sbjct: 699 ISRPGAVETLEQYKFCYD 716 >SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1751 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/78 (35%), Positives = 47/78 (60%) Frame = +2 Query: 8 SLVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTV 187 S+++L++ V+ +Q+ + V +G R+G +CA + +E++ VDVFQ VK + Sbjct: 1630 SVLDLVSWVQLSQQQCGDKAIVVQCSNGVGRSGTFCAIYSLLERIKAEQVVDVFQTVKVL 1689 Query: 188 RRHRPQLVENMTEYKYCY 241 R RP VE +T+Y YCY Sbjct: 1690 RLGRPGAVETLTQYIYCY 1707 >SB_25734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1938 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/78 (32%), Positives = 48/78 (61%) Frame = +2 Query: 8 SLVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTV 187 S+++L++ + +Q+ PV V +G R+G +CA ++ +E++ +DVFQ +K + Sbjct: 1842 SVLDLLDEAQTSQQQCGNAPVLVQCSNGVGRSGTFCAISSVLERLKTEQVIDVFQVIKRI 1901 Query: 188 RRHRPQLVENMTEYKYCY 241 R + P VE+ T+Y +CY Sbjct: 1902 RVNLPGAVESPTQYLFCY 1919 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +2 Query: 56 DYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKY 235 D GPV V G R G Y +A +EQ K VD+ + +R+ RP +V+ +Y + Sbjct: 1588 DAGPVIVHCSAGVERTGTYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQTKEQYSF 1647 Query: 236 CY 241 + Sbjct: 1648 IH 1649 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 56.0 bits (129), Expect = 2e-08 Identities = 26/68 (38%), Positives = 39/68 (57%) Frame = +2 Query: 11 LVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVR 190 L++L+ V+RW+Q+ V G R GV+CA + IE++ VDVFQ VK +R Sbjct: 3597 LIDLIGQVQRWQQKCGVQLTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLR 3656 Query: 191 RHRPQLVE 214 RP +V+ Sbjct: 3657 EQRPAMVQ 3664 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +2 Query: 5 NSLVELMNMVERWRQ---RTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQA 175 NS+ ++N V + DYGP+ V G R G Y +A ++++ VDV+ Sbjct: 3279 NSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNY 3338 Query: 176 VKTVRRHRPQLVENMTEYKYCYD 244 V +R R +V+ +Y +D Sbjct: 3339 VMMLRGQRNLMVQVEDQYVLIHD 3361 >SB_30129| Best HMM Match : Y_phosphatase (HMM E-Value=6.7e-13) Length = 139 Score = 55.2 bits (127), Expect = 4e-08 Identities = 25/68 (36%), Positives = 39/68 (57%) Frame = +2 Query: 11 LVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVR 190 L++L+ V+ W+ + P+ V G R GV+CA + IE++ VDVFQ VK +R Sbjct: 70 LIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLR 129 Query: 191 RHRPQLVE 214 RP +V+ Sbjct: 130 EQRPAMVQ 137 >SB_25091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 54.8 bits (126), Expect = 6e-08 Identities = 21/52 (40%), Positives = 36/52 (69%) Frame = +2 Query: 86 DGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 +G R+G +CA ++ IE++ +DVFQ +K +R +RP VE++T+Y +CY Sbjct: 162 NGVGRSGTFCAISSVIERLKTEQVIDVFQVIKRIRANRPGAVESLTQYVFCY 213 >SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 839 Score = 54.8 bits (126), Expect = 6e-08 Identities = 22/68 (32%), Positives = 41/68 (60%) Frame = +2 Query: 11 LVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVR 190 +++++ + R +Q+T GP+ V DG R G +CA + +E+V +D+FQ V+ +R Sbjct: 740 VIDMLKHIARAQQQTGNGPITVHCSDGSGRTGTFCAISIALERVKLDATIDMFQTVRNLR 799 Query: 191 RHRPQLVE 214 RP +V+ Sbjct: 800 TQRPIMVQ 807 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +2 Query: 56 DYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVE 214 D GP+ V G R G Y +A ++Q+ K G VD+F V R R +V+ Sbjct: 357 DAGPIVVHCSAGVGRTGTYIVLDAMLDQMSKEGAVDIFGFVSHTRLQRNMMVQ 409 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/75 (36%), Positives = 44/75 (58%) Frame = +2 Query: 8 SLVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTV 187 S +ELM+ V+R +Q+ P+ V G +R+G +CA + +E++ VDVFQ +K + Sbjct: 1461 SALELMSEVQRSQQQAKNRPIIVQCSTGTTRSGAFCAIYSILERLKIEQVVDVFQVIKVI 1520 Query: 188 RRHRPQLVENMTEYK 232 R RPQ V ++ K Sbjct: 1521 RIKRPQSVTSLAPKK 1535 >SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 2064 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +2 Query: 11 LVELMNMVER-WRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTV 187 +++L+ V+R + Q+ + GP+ V DG R GV+ A +E++ G VD+FQ VK + Sbjct: 1963 IIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLL 2022 Query: 188 RRHRPQLVEN 217 R RP +V++ Sbjct: 2023 RTQRPAMVQS 2032 Score = 35.5 bits (78), Expect = 0.037 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +2 Query: 56 DYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKY 235 D GP+ V G R G + ++ +E++ VD++ V +R R +V+ +Y + Sbjct: 1688 DAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIF 1747 Query: 236 CYD 244 +D Sbjct: 1748 SHD 1750 >SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/73 (36%), Positives = 40/73 (54%) Frame = +2 Query: 5 NSLVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKT 184 N LV L V++ + D+GP V DG R GV+ A IE++ VD+FQ V+ Sbjct: 756 NGLVFLHEQVQKIQSTEDHGPTVVHCSDGAGRTGVFLALAISIERLEAEDTVDIFQTVRW 815 Query: 185 VRRHRPQLVENMT 223 +R RP LV +++ Sbjct: 816 LRSQRPALVGSIS 828 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/61 (31%), Positives = 33/61 (54%) Frame = +2 Query: 62 GPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 GP+ V G R G + A ++ ++Q++ G VDV+ V +R R +V+ +Y + Y Sbjct: 486 GPILVHCGAGVGRTGTFIAIDSLMDQMVMEGVVDVYGFVAQMRTQRNFMVQTHEQYAFIY 545 Query: 242 D 244 D Sbjct: 546 D 546 >SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1252 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = +2 Query: 11 LVELMNMVERWRQRTDYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQ 172 L++L+ VE+W+Q++ + V G R GV+CA + IE+V G +DVFQ Sbjct: 1129 LIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQ 1182 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = +2 Query: 62 GPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 GP+ V G R G + ++ +++ + G +DVF V+ +R R +V+ ++Y + + Sbjct: 882 GPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIH 941 Query: 242 D 244 D Sbjct: 942 D 942 >SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 979 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +2 Query: 56 DYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKY 235 D GPV V G R G Y +A +EQ K VD+ + +R+HRP +V+ +Y + Sbjct: 570 DAGPVIVHCSVGVERTGAYIVIDAMLEQAKKSRTVDIRNYLIAIRKHRPHMVQTKEQYSF 629 Query: 236 CY 241 + Sbjct: 630 IH 631 >SB_12732| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 800 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 2/79 (2%) Frame = +2 Query: 11 LVELMNMVERWRQRTD--YGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKT 184 L++L++ V + R D GPV V G R G + A + I+Q+ K +VD+ + V Sbjct: 493 LLQLVDEVHLAQDRDDGKTGPVVVHCSAGIGRTGCFVATSIGIKQIQKENKVDILKIVCG 552 Query: 185 VRRHRPQLVENMTEYKYCY 241 +R R +VE ++Y++ Y Sbjct: 553 MRMERGGMVETDSQYEFVY 571 >SB_47814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1492 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +2 Query: 56 DYGPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKY 235 D GPV V G R G Y +A +EQ + VD+ + +R+ RP +V+ +Y + Sbjct: 1072 DAGPVIVHCSAGVGRTGAYIVIDAMLEQAKINRTVDIRNYLIALRKDRPHMVQTKEQYSF 1131 Query: 236 CY 241 + Sbjct: 1132 IH 1133 >SB_54099| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) Length = 97 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 89 GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 G R G + +A + Q K VD+F VK +R RP +V+ +Y + + Sbjct: 3 GVGRTGAFLVIDAMLRQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIH 53 >SB_52620| Best HMM Match : Y_phosphatase (HMM E-Value=9.3e-06) Length = 324 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 89 GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 G R G + +A + Q K VD+F VK +R RP +V+ +Y + + Sbjct: 206 GVGRTGAFLVMDAMLRQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIH 256 >SB_50464| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) Length = 96 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 89 GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 G R G + +A + Q K VD+F VK +R RP +V+ +Y + + Sbjct: 3 GVGRTGAFLVIDAMLRQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIH 53 >SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 753 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 89 GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 G R G + +A + Q K VD+F VK +R RP +V+ +Y + + Sbjct: 660 GVGRTGAFLVIDAMLRQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIH 710 >SB_47501| Best HMM Match : Y_phosphatase (HMM E-Value=9e-12) Length = 274 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +2 Query: 89 GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCYD 244 G R+G + +A +++V +D+F V +R R +V+ +Y +C+D Sbjct: 3 GVGRSGTFIVIDAMLDRVNAESSLDIFNYVAYLRTRRTAMVQTEEQYTFCHD 54 >SB_21229| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 629 Score = 35.9 bits (79), Expect = 0.028 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = +2 Query: 53 TDYGPVCVVSPD-----GRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVEN 217 T + P+ VSP G R G Y +A +EQ K VD+ + +R+ RP +V+ Sbjct: 414 TCHRPLQYVSPSLFFSAGVERTGTYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQT 473 Query: 218 MTEYKYCY 241 +Y + + Sbjct: 474 KEQYSFIH 481 >SB_40495| Best HMM Match : Y_phosphatase (HMM E-Value=2.8e-06) Length = 118 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +2 Query: 62 GPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVE 214 GP+ V G R+G + ++ I+++ +G++D+F + +R R LV+ Sbjct: 66 GPLVVHCSAGVGRSGAFIVIDSMIKRIHDNGDLDIFNFLAHIRNQRNHLVQ 116 >SB_30310| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 990 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/58 (22%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 65 PVCVVSPDGRSRAGVYCAANACIEQVIKHG-EVDVFQAVKTVRRHRPQLVENMTEYKY 235 P+ V G R G Y + + ++++ E+D+ V+ +R RP +V+ ++++ Sbjct: 539 PIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEF 596 >SB_34699| Best HMM Match : Peptidase_S8 (HMM E-Value=1.5e-07) Length = 785 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 347 GAALPTTPEETSPSAAPRDHKRPQRP 424 G +P PEE SPS H +P RP Sbjct: 596 GCHVPLRPEEVSPSVTLNTHAQPLRP 621 >SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 7/40 (17%) Frame = +2 Query: 326 WFIEFGRGAALP-------TTPEETSPSAAPRDHKRPQRP 424 W + FG G +P TTP ET PS RP++P Sbjct: 2104 WGLVFGGGIKVPQASSSEATTPTETKPSLPTGTRDRPRKP 2143 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 27.9 bits (59), Expect = 7.5 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 7/61 (11%) Frame = +1 Query: 10 TSGADEHGGTLATADRLRTSLRCI----TGWTQPGRGLLRSQRVHR---TSHKARRGGRV 168 T+ A + +ATA +L C T W GR RS R R ++HKA GGR Sbjct: 633 TNRAKKEALRVATAQQLPAGASCRVHAHTSWWPRGRAGFRSARSGRRRDSAHKATAGGRT 692 Query: 169 S 171 + Sbjct: 693 A 693 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +2 Query: 62 GPVCVVSPDGRSRAGVYCAANACIEQVIKHGEVDVFQAVKTVRRHRPQLVENMTEYKYCY 241 GP +P+ R+ G Y N + V + + TVR R ++ + ++E+K C Sbjct: 42 GPYHRFTPEQRAEIGHYALENGTAKAVRLYKNEFPTLSESTVRNFRDKVKKLLSEHKACE 101 Query: 242 D 244 D Sbjct: 102 D 102 >SB_50357| Best HMM Match : Toxin_8 (HMM E-Value=2.4) Length = 304 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 365 TPEETSPSAAPRDHKRPQRPRRGLS 439 TP S +PR H RP RP R S Sbjct: 120 TPRPPSTPPSPRKHSRPCRPTRSQS 144 >SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) Length = 201 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 13 SGADEHGGTLATADRLRTSL-RCITGWTQPGRGLLRSQRVHRTSH 144 SGA HGGT+ L S+ R I W Q + L RV H Sbjct: 132 SGAKGHGGTIVNVASLAESIQRPIQSWIQKRQPLDNIPRVKSVFH 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,964,382 Number of Sequences: 59808 Number of extensions: 260173 Number of successful extensions: 1102 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -