BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0076 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 26 0.36 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 24 1.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 24 1.4 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 7.7 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 7.7 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 25.8 bits (54), Expect = 0.36 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 146 KHGEVDVFQAVKTVRRHRPQLVENMTEYKYCYD 244 K+G++ + + +K +R RP Y YCY+ Sbjct: 191 KYGQLFMEETLKAAKRMRPAANWGYYAYPYCYN 223 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 102 ARLRPSGDTTQTGP*SVRCRQRSTMFISSTSEL 4 AR+RPSG+ GP VR +F+ S S++ Sbjct: 45 ARIRPSGENATDGPAVVRV----NIFVRSISKI 73 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 102 ARLRPSGDTTQTGP*SVR 49 AR+RPSG+ GP VR Sbjct: 45 ARIRPSGENATDGPAIVR 62 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 112 VDPGPAASIR*YNADWSVVCPLSPAFHHV 26 VD P + +A+W PL+P +H + Sbjct: 26 VDKVPPDMLHLIDANWYQYPPLNPMWHGI 54 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 55 RLRTSLRCITGWTQPGR 105 R++ S C GW P R Sbjct: 144 RVKDSTNCNCGWKNPSR 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,993 Number of Sequences: 438 Number of extensions: 2198 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -