BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0074 (903 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 67 2e-13 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 5.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 6.7 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 66.9 bits (156), Expect = 2e-13 Identities = 34/41 (82%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 768 EMATAASSSSLEKSYELPDGQVITIGNQRF-VARGSFQPSF 887 EMATAASSSSLEKSYELPDGQVITIGN+RF FQPSF Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSF 41 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 372 LRVAPEEHPVLLTEAPLNPKANREKM 449 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 5.0 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +2 Query: 515 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 646 ++ +++HR C P +L +I + P HP + S S P Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 6.7 Identities = 12/34 (35%), Positives = 12/34 (35%), Gaps = 1/34 (2%) Frame = +2 Query: 602 TP-PRHPASGLSRSRPHRLPHEDPHRARLLVHYH 700 TP P H G S H PH A H H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQH 444 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,313 Number of Sequences: 438 Number of extensions: 6837 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -