BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0072 (470 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46556| Best HMM Match : CDtoxinA (HMM E-Value=1.1) 28 3.4 SB_29103| Best HMM Match : APC10 (HMM E-Value=0.00051) 27 7.8 >SB_46556| Best HMM Match : CDtoxinA (HMM E-Value=1.1) Length = 208 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 188 LRTASLHHYVLYI*NKSIQINNCIALRSINIYITFIFHSLS 310 LR+ +LH V + +SI ++ C+ LRSI ++ F S++ Sbjct: 13 LRSITLHECVTF---RSITMHECVTLRSITLHECVTFWSIT 50 >SB_29103| Best HMM Match : APC10 (HMM E-Value=0.00051) Length = 717 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +3 Query: 294 FFTAYQNCCRYKNIQTYENIVDKS*SRRRVGFAKGTPQWKLLLEWKLRTR 443 F + C + Y D S ++RR GT +W L L++K R Sbjct: 611 FTVEFDPRCETERKYDYLEFTDSSGNKRRFDQKVGTDKWPLTLQFKAGNR 660 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,807,165 Number of Sequences: 59808 Number of extensions: 208953 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -