BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0072 (470 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69718-1|CAA93535.1| 119|Caenorhabditis elegans Hypothetical pr... 28 3.9 DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-t... 27 5.1 AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-t... 27 5.1 AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel... 27 5.1 AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel... 27 5.1 AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel... 27 5.1 U39644-2|AAA80360.2| 966|Caenorhabditis elegans Hypothetical pr... 27 9.0 >Z69718-1|CAA93535.1| 119|Caenorhabditis elegans Hypothetical protein W06D11.2 protein. Length = 119 Score = 27.9 bits (59), Expect = 3.9 Identities = 19/73 (26%), Positives = 39/73 (53%) Frame = +2 Query: 248 NNCIALRSINIYITFIFHSLSKLLSLQKYPNV*KYSGQKLKSSPRRVR*RHSAVEIITRV 427 N +A +I+ + FIF SLS +++L K P+ K + Q+++ + ++ ++I R+ Sbjct: 35 NPRVAHPAIHQTVVFIFDSLSSIIALNKLPHT-KENRQQVECGFKSMQ---YLEDLIIRI 90 Query: 428 EITNENSTVTEGG 466 + E+ V G Sbjct: 91 VVRGEDPAVIHEG 103 >DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1797 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 379 RRRLQLLSTIFSYVWIFL 326 R R+ LL T+F +WIFL Sbjct: 1264 RNRVDLLITVFGVIWIFL 1281 >AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1831 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 379 RRRLQLLSTIFSYVWIFL 326 R R+ LL T+F +WIFL Sbjct: 1298 RNRVDLLITVFGVIWIFL 1315 >AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform a protein. Length = 1562 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 379 RRRLQLLSTIFSYVWIFL 326 R R+ LL T+F +WIFL Sbjct: 1356 RNRVDLLITVFGVIWIFL 1373 >AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform c protein. Length = 1913 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 379 RRRLQLLSTIFSYVWIFL 326 R R+ LL T+F +WIFL Sbjct: 1409 RNRVDLLITVFGVIWIFL 1426 >AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform d protein. Length = 1861 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 379 RRRLQLLSTIFSYVWIFL 326 R R+ LL T+F +WIFL Sbjct: 1328 RNRVDLLITVFGVIWIFL 1345 >U39644-2|AAA80360.2| 966|Caenorhabditis elegans Hypothetical protein T10E10.4 protein. Length = 966 Score = 26.6 bits (56), Expect = 9.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 378 GDDFSFCPLYFHTFGYFCNDNNFDK 304 G FS CP FH G FC ++ DK Sbjct: 922 GRCFSQCPRGFHESGAFCMHDDEDK 946 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,142,611 Number of Sequences: 27780 Number of extensions: 164782 Number of successful extensions: 355 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 355 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 850313440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -