BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0071 (797 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0917 - 29404341-29404519,29404610-29404744,29404898-294052... 29 3.2 >04_04_0917 - 29404341-29404519,29404610-29404744,29404898-29405225, 29405313-29405532,29405653-29406647,29407233-29407493, 29407534-29407872,29409309-29409497 Length = 881 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/82 (30%), Positives = 39/82 (47%) Frame = +1 Query: 352 NRVTKILRPPVVRRRDGKSQQLQLTGNRKSLRLSDAYHKFKKRIYFIHD*LTRQTSQCLN 531 NR+ K LR + DG LQ N+ S + + ++K ++ + D + Q SQCL Sbjct: 227 NRIWKCLR---LGANDGNLANLQ---NKSSTNMVNLVRQYKPKV--VED-NSSQVSQCLK 277 Query: 532 RLIKDLTLLYKINLKQTKNNPV 597 D L K+NL ++ N V Sbjct: 278 HGSMDFLGLEKLNLNASQLNAV 299 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,152,850 Number of Sequences: 37544 Number of extensions: 277318 Number of successful extensions: 491 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -