BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0071 (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084197-5|AAO38574.1| 335|Caenorhabditis elegans Serpentine re... 30 2.2 AC084197-4|AAO38575.1| 335|Caenorhabditis elegans Serpentine re... 28 8.9 >AC084197-5|AAO38574.1| 335|Caenorhabditis elegans Serpentine receptor, class v protein26 protein. Length = 335 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 231 VLELLFCFCTVLIFKVNFRYLSRLRISCIVWFRRCIY 121 V LLF F +LIF Y SR +++ +++ R IY Sbjct: 226 VFVLLFAFFAILIFYAILNYCSRAQMTAEMFYLRTIY 262 >AC084197-4|AAO38575.1| 335|Caenorhabditis elegans Serpentine receptor, class v protein27 protein. Length = 335 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 231 VLELLFCFCTVLIFKVNFRYLSRLRISCIVWFRRCIY 121 VL LLF F +L+F Y SR + + +++ R +Y Sbjct: 226 VLVLLFAFFLILVFYTFLNYFSRTQNNGPIFYMRGLY 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,140,406 Number of Sequences: 27780 Number of extensions: 283254 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -