BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0070 (454 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1742 - 39585879-39585994,39586089-39586238,39586288-395863... 27 9.3 >01_06_1742 - 39585879-39585994,39586089-39586238,39586288-39586375, 39586479-39586640,39586753-39586877,39586992-39587030, 39587290-39587476,39587643-39587713,39589371-39589564, 39589656-39589767,39589899-39590082,39590177-39590503, 39590780-39591061,39591148-39591621,39591730-39591813, 39591850-39591939,39592024-39592247,39592503-39592600, 39592679-39593169,39593249-39593520,39594266-39594522, 39594672-39594890,39595007-39595167,39595249-39595441, 39595528-39595633,39595947-39596121,39596404-39596556, 39596663-39596794,39597120-39597184,39597754-39597819, 39598433-39598511,39598587-39598767,39598864-39598976 Length = 1889 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 7/53 (13%) Frame = -2 Query: 147 DILNSNYVF-FNCFTNASELFDIRNVSI---NIFQYFIRYS---YFRHSSNLI 10 DIL + Y+F + TN EL D+R+ S+ N Q ++++ + +HSS L+ Sbjct: 1222 DILLTRYLFNSHKDTNEGELTDLRSASVNNENFAQVAVKHNFHHFLQHSSGLL 1274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,331,700 Number of Sequences: 37544 Number of extensions: 117502 Number of successful extensions: 226 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -