BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0070 (454 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 0.67 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 24 0.89 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 21 4.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 4.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.3 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.2 bits (50), Expect = 0.67 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = -2 Query: 126 VFFNCFTNASELFDIRNVSINIFQYFIRYSYFRHS 22 ++F+ A + +R+ NIFQ ++ YF ++ Sbjct: 10 LYFSIVCQAKAHYSLRDFKANIFQVKYQWKYFDYN 44 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.8 bits (49), Expect = 0.89 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 162 KFFSEDILNSNYVFFNC 112 +F S +LN N +FFNC Sbjct: 140 RFKSFSLLNFNLLFFNC 156 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 76 RQHQYFSIFYSVLIFSTFLESNLKK 2 + + +F I LIF F E+++KK Sbjct: 3 KNYHFFFILVITLIFLYFGEADIKK 27 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 4.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -2 Query: 249 NVFIAQMGELVSTYPIIIKTIK*DRRLDFKFFSEDILNS 133 N ++ + +V+T PI+ K + DF F +EDIL++ Sbjct: 1389 NEYLDKADVIVNT-PIMDAHFKDVKLSDFGFSTEDILDT 1426 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 8.3 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -1 Query: 250 KCFYCADG*VSFD 212 KC++C DG + D Sbjct: 426 KCYFCLDGKLPHD 438 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,941 Number of Sequences: 438 Number of extensions: 1779 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -