Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0066
         (678 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC4G3.07c |phf1|swp1, saf50|PHD finger containing protein Phf1...    26   4.4  

>SPCC4G3.07c |phf1|swp1, saf50|PHD finger containing protein
           Phf1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 461

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = -1

Query: 549 DLKWLVANSASP*YSCPLLLYCTLFYPHTPTYYLK*RFEFLGHTNNFSLRSSDSLRLKM 373
           D K  +++  +P +   L+L+C   YP  P Y  + R E LG   +  L SS+  ++ +
Sbjct: 267 DKKMYLSSLPTP-HLADLILFCEKSYPSLPIYNPRTR-ELLGEIRHQLLVSSERQQISL 323


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,788,817
Number of Sequences: 5004
Number of extensions: 55717
Number of successful extensions: 109
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 108
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 311890690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)