BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0065 (403 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 0.75 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 0.99 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 0.99 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 5.3 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 20 9.2 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 0.75 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +1 Query: 130 KLVQALCNEHQIPLVKVDNNKKLGEWAGLCKIDKDGKARK--IVGCSCV 270 KL+ + E L +VD + LGE L D K +K + GC CV Sbjct: 564 KLIDNIKKEIYDILPEVDVEEILGEAKVLQNFDIKDKNKKVNVAGCRCV 612 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 0.99 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 167 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 286 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 0.99 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 167 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 286 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 178 P*PVESDVRCTEPEQVSCMRLHHSSQ 101 P VESD ++P+Q++ R S+Q Sbjct: 1777 PGDVESDESESDPDQLTSSRTESSNQ 1802 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 178 P*PVESDVRCTEPEQVSCMRLHHSSQ 101 P VESD ++P+Q++ R S+Q Sbjct: 1773 PGDVESDESESDPDQLTSSRTESSNQ 1798 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.0 bits (42), Expect = 5.3 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = -3 Query: 269 TQEQPTIFLALPSL 228 T++Q T+F+A+P + Sbjct: 67 TEQQSTVFVAIPRI 80 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 20.2 bits (40), Expect = 9.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 46 LHEAAKALDKRQAVLC 93 +H+A K L++R LC Sbjct: 79 IHDAYKDLNQRYGALC 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,745 Number of Sequences: 438 Number of extensions: 1726 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -