BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0062 (901 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 24 2.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 24 2.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 3.8 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.8 bits (49), Expect = 2.2 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 278 CWSGQPTRRLKTTETISIKFVYLQFTRRSP--EDRSAKEIQE 159 CWSG+P++R + + Q +RS ++ S+ ++QE Sbjct: 838 CWSGEPSKRPLLGAIVPVLESIQQKAKRSKSLQEVSSDKLQE 879 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.8 bits (49), Expect = 2.2 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 278 CWSGQPTRRLKTTETISIKFVYLQFTRRSP--EDRSAKEIQE 159 CWSG+P++R + + Q +RS ++ S+ ++QE Sbjct: 876 CWSGEPSKRPLLGAIVPVLESIQQKAKRSKSLQEVSSDKLQE 917 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.0 bits (47), Expect = 3.8 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -1 Query: 553 DENLMDAILLGAKR--IGHAYALAKHPLLLEEVIKNDIGLEINIISNAVLSLVRDVRN 386 +EN L KR H A L ++ + + LE+++I VLS+ R++ N Sbjct: 447 NENYKSLNLAAQKREYYSHYVAFKSLSYLKKQPVIANGSLEVDVIDGRVLSVKRELGN 504 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,720 Number of Sequences: 438 Number of extensions: 5487 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -