BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0061 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo... 29 0.58 SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|c... 25 9.5 SPBC16A3.07c |nrm1||negative regulator of MBF|Schizosaccharomyce... 25 9.5 >SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 301 CAH-CTESRRSPYSFGGMFRTSGYESECGRCFTCSRKI 411 CAH CT R + M Y EC RC C ++I Sbjct: 74 CAHTCTACRMRIKDYALMSGYDSYHRECFRCHDCRKQI 111 >SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 50 ITFCFKKMVTIIKNQLLKHLSRFTKNLSPE 139 I FC + +TIIKN++ K + + + S E Sbjct: 371 IVFCSEIQLTIIKNEIRKKIYKCLASASEE 400 >SPBC16A3.07c |nrm1||negative regulator of MBF|Schizosaccharomyces pombe|chr 2|||Manual Length = 342 Score = 25.0 bits (52), Expect = 9.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 514 P*NLNTTGERITVEVYLY 461 P LNT GER T EVY Y Sbjct: 10 PSRLNTLGERPTNEVYEY 27 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,597,916 Number of Sequences: 5004 Number of extensions: 51573 Number of successful extensions: 113 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -