BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0061 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 26 0.27 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 1.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.4 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 22 4.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.8 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 26.2 bits (55), Expect = 0.27 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 374 PSAAGALPVPGKYSYIHKVIDGISVAVNHV 463 PS + ALP+ GKY ++ G+SV + V Sbjct: 289 PSTSLALPLLGKYLLFTMILVGLSVVITIV 318 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = +1 Query: 379 CGRCFTCSRKI*LYTQ 426 CG+ FTCS+++ ++T+ Sbjct: 209 CGKGFTCSKQLKVHTR 224 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 609 LKISSCPVSVHLILVSLRSPFRPSGV 532 + I + +S ILVS R P +P+GV Sbjct: 1184 IAIKALVMSSESILVSWRPPSQPNGV 1209 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +2 Query: 425 KVIDGISVAVNHVQIDFNCDAFTSSVQISRVTV 523 K+IDG VA+N D +++ +++ + V Sbjct: 132 KIIDGHVVAINETTYTDGSDDYSTLIRVRVIDV 164 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 107 LSRFTKNLSPEQISLSALRGSG 172 LS F + SPE + + L+G G Sbjct: 187 LSDFVIHRSPELVPMPTLKGDG 208 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,353 Number of Sequences: 438 Number of extensions: 3900 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -