BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0060 (779 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.68 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 23 3.6 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 4.8 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 22 6.3 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 22 6.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.68 Identities = 19/78 (24%), Positives = 27/78 (34%), Gaps = 7/78 (8%) Frame = +2 Query: 536 TNEDLVTFVATVPPAVGCV----TASWRHATAASGSR---TRWAAPSRPASRGGPVPNSP 694 +N ++V V T PA T SW + + T W P P S P+P Sbjct: 1332 SNVNVVDIVTTAKPAQSTTSVSTTTSWNPGSTTNYPEWQPTEWHPPIPPTSEKPPLPEEL 1391 Query: 695 YNESYYNSLAVLLQRPDW 748 +S Y + W Sbjct: 1392 KPQSGYFKIVCYFTNWAW 1409 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 643 GCAFTACLEGGPGTQFAL 696 GC T C GG ++FA+ Sbjct: 20 GCLITNCPRGGKRSKFAI 37 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 5 YPFSLLHTSILTFASLLHAIAFHPPL-YP 88 +P++ ++T AS+ HA A PL YP Sbjct: 135 WPYAAVYTDPAFAASIFHAAATSLPLHYP 163 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 553 YICRDGTTRRWMC 591 YIC +GT R + C Sbjct: 182 YICLEGTAREYGC 194 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 553 YICRDGTTRRWMC 591 YIC +GT R + C Sbjct: 182 YICLEGTAREYGC 194 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,240 Number of Sequences: 336 Number of extensions: 3005 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -