BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0060 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) 167 9e-42 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 66 3e-11 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 65 5e-11 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 64 9e-11 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 64 1e-10 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 64 2e-10 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 64 2e-10 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_27365| Best HMM Match : PID (HMM E-Value=1.90001e-40) 64 2e-10 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_12554| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 63 2e-10 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 63 2e-10 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 63 3e-10 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 63 3e-10 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 63 3e-10 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17580| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 63 3e-10 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 62 4e-10 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 62 4e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 62 5e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 62 5e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 62 5e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 62 5e-10 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_47452| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 62 5e-10 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 62 6e-10 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 62 6e-10 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 62 6e-10 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_49651| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) 62 6e-10 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) 62 6e-10 SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) 62 6e-10 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 62 6e-10 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_8768| Best HMM Match : TrmB (HMM E-Value=0.86) 62 6e-10 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 62 6e-10 SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 61 9e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 61 9e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 61 9e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 61 9e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 61 9e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 61 9e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 61 9e-10 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 61 9e-10 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 61 9e-10 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 61 9e-10 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 61 9e-10 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 61 9e-10 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 61 9e-10 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 61 9e-10 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 61 9e-10 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 61 9e-10 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 61 9e-10 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 61 9e-10 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 61 9e-10 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 61 9e-10 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 61 9e-10 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 61 9e-10 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 61 9e-10 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 61 9e-10 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 61 9e-10 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 61 9e-10 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 61 9e-10 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 61 9e-10 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 61 9e-10 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 61 9e-10 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 61 9e-10 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 61 9e-10 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 61 9e-10 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 61 9e-10 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 61 9e-10 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 61 9e-10 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 61 9e-10 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 61 9e-10 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 61 9e-10 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 61 9e-10 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 61 9e-10 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 61 9e-10 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 61 9e-10 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 >SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) Length = 591 Score = 167 bits (406), Expect = 9e-42 Identities = 82/141 (58%), Positives = 101/141 (71%), Gaps = 1/141 (0%) Frame = +1 Query: 250 PESARPHQWHADEAAVRAGTCTFPVKYLGCVEVFESRGMQVCEEALKVLRNSR-RRPIRA 426 PES RP W D VR G +FPVKY+G +EV ESRG QVC EA + +R + + R Sbjct: 98 PESHRPQVWENDSYKVRNGGVSFPVKYVGAIEVTESRGTQVCAEAFRKMREAGVHKKKRM 157 Query: 427 VLHVSGDGLRVVEEETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLA 606 L V+ D +RVV+EETK ++ TI+ V FC PD + +R FSYICR+GTTRRWMCH F+A Sbjct: 158 NLLVTSDCIRVVDEETKVVLPLTTIKGV-FCTPDPSDDRVFSYICREGTTRRWMCHCFIA 216 Query: 607 SRDSGERLSHAVGCAFTACLE 669 RD+GERLSHAVGCAFTACL+ Sbjct: 217 IRDTGERLSHAVGCAFTACLQ 237 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 70.5 bits (165), Expect = 1e-12 Identities = 37/69 (53%), Positives = 42/69 (60%), Gaps = 5/69 (7%) Frame = +2 Query: 584 GCVTASWRHATAASGSR-TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDW 748 G V A W H GS+ + +P P P P NSPY+ESYYNSLAV+LQR DW Sbjct: 2 GAVEACWAHNPEVRGSKPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDW 61 Query: 749 ENPAVTQLN 775 ENP VTQLN Sbjct: 62 ENPGVTQLN 70 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 67.3 bits (157), Expect = 1e-11 Identities = 37/74 (50%), Positives = 45/74 (60%), Gaps = 5/74 (6%) Frame = +2 Query: 569 VPPAVGCVTASWRHATAASGSR-TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLL 733 V PAVG V +A + ++ + +P P P P NSPY+ESYYNSLAV+L Sbjct: 6 VEPAVGVVKEQQGELSAGTSAKESNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVL 65 Query: 734 QRPDWENPAVTQLN 775 QR DWENP VTQLN Sbjct: 66 QRRDWENPGVTQLN 79 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.9 bits (156), Expect = 2e-11 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 + A ++ G R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 22 KFAASSRGGRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 81 Query: 773 N 775 N Sbjct: 82 N 82 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/56 (58%), Positives = 36/56 (64%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A R W +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 8 APKKRRAWKSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 66.5 bits (155), Expect = 2e-11 Identities = 35/64 (54%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = +2 Query: 596 ASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAV 763 A+ H A+ S R +P P P P NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 28 AATAHVRVATMSSRRKKSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 87 Query: 764 TQLN 775 TQLN Sbjct: 88 TQLN 91 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.1 bits (154), Expect = 3e-11 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 WR + GS + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 32 WRFGVGSRGSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 89 Query: 770 LN 775 LN Sbjct: 90 LN 91 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.1 bits (154), Expect = 3e-11 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 ASG++ + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 28 ASGTQCKVPSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 83 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.1 bits (154), Expect = 3e-11 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 7/67 (10%) Frame = +2 Query: 596 ASWR-HATAASG--SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWEN 754 + WR H+ ASG S + +P P P P NSPY+ESYYNSLAV+LQR DWEN Sbjct: 5 SDWRLHSGKASGLHSGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWEN 64 Query: 755 PAVTQLN 775 P VTQLN Sbjct: 65 PGVTQLN 71 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 66.1 bits (154), Expect = 3e-11 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +2 Query: 593 TASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPA 760 +AS R + +S + + +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 502 SASARESVPSSSTPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 561 Query: 761 VTQLN 775 VTQLN Sbjct: 562 VTQLN 566 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 680 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 709 >SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) Length = 386 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R +GS + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 253 RELIGLTGSNVKALSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 312 Query: 773 N 775 N Sbjct: 313 N 313 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 65.3 bits (152), Expect = 5e-11 Identities = 34/67 (50%), Positives = 39/67 (58%), Gaps = 4/67 (5%) Frame = +2 Query: 587 CVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWEN 754 C A +T S + +P P P P NSPY+ESYYNSLAV+LQR DWEN Sbjct: 32 CAAAGLTKSTTESTITSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWEN 91 Query: 755 PAVTQLN 775 P VTQLN Sbjct: 92 PGVTQLN 98 >SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 64.9 bits (151), Expect = 7e-11 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 4/49 (8%) Frame = +2 Query: 641 WAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 W +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 26 WQSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 64.9 bits (151), Expect = 7e-11 Identities = 39/95 (41%), Positives = 49/95 (51%) Frame = +2 Query: 491 IRPSRRCPSARPTEITNEDLVTFVATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASR 670 +R R + + +TN+ F+ P + V R + S S RP R Sbjct: 69 LRNKARKTNRKLNSLTNKQDSRFLHDFPDEIPVVGLKHRDQRSNSCSPGDPLVLERPPPR 128 Query: 671 GGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 129 WSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 161 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 64.9 bits (151), Expect = 7e-11 Identities = 36/61 (59%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 RH AAS S +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 21 RHLQAASNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 76 Query: 773 N 775 N Sbjct: 77 N 77 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.9 bits (151), Expect = 7e-11 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = +2 Query: 611 ATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 AT + +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 5 ATTTTLTRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 64.5 bits (150), Expect = 9e-11 Identities = 43/95 (45%), Positives = 47/95 (49%), Gaps = 5/95 (5%) Frame = +2 Query: 506 RCPSARPTEITNEDLVTFV-ATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPV 682 R P T E + V A V GC R A S S +P P P Sbjct: 7 RLTKVLPAPFTVERALAHVGANVVIQSGCARKRARAEAALSNS----CSPGDPLVLERPP 62 Query: 683 P----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 63 PRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 97 >SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) Length = 275 Score = 64.5 bits (150), Expect = 9e-11 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +AA G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 145 SAAVGGGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 202 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 64.5 bits (150), Expect = 9e-11 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 4/71 (5%) Frame = +2 Query: 575 PAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRP 742 P V+A +R+ S S +P P P P NSPY+ESYYNSLAV+LQR Sbjct: 56 PKSSAVSALYRYVMTPSNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRR 111 Query: 743 DWENPAVTQLN 775 DWENP VTQLN Sbjct: 112 DWENPGVTQLN 122 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 64.1 bits (149), Expect = 1e-10 Identities = 34/63 (53%), Positives = 39/63 (61%), Gaps = 5/63 (7%) Frame = +2 Query: 602 WRHATAA-SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVT 766 WR A +G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VT Sbjct: 6 WRENEAKKAGGGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 65 Query: 767 QLN 775 QLN Sbjct: 66 QLN 68 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 64.1 bits (149), Expect = 1e-10 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 5/67 (7%) Frame = +2 Query: 590 VTASWRHATAAS-GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWEN 754 ++A+ R A S SR+ +P P P P NSPY+ESYYNSLAV+LQR DWEN Sbjct: 9 ISANIRCKRAGSLRSRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWEN 68 Query: 755 PAVTQLN 775 P VTQLN Sbjct: 69 PGVTQLN 75 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R+ + S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 200 RNVRVKTASGAEYQSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 259 Query: 773 N 775 N Sbjct: 260 N 260 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R + A+ R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 6 RKSNASRTLRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 65 Query: 773 N 775 N Sbjct: 66 N 66 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/62 (51%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 W + R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 7 WEQRRKPARPRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 66 Query: 770 LN 775 LN Sbjct: 67 LN 68 >SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 ++A G+ + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 3 KNAPGTFGNSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 62 Query: 773 N 775 N Sbjct: 63 N 63 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 H +A+ S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 6 HPSASFLSSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 23 GHRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 ++A R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 1 SSARNERSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 63.7 bits (148), Expect = 2e-10 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +2 Query: 650 PSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 P RP R NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 9 PERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 48 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 63.7 bits (148), Expect = 2e-10 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Frame = +2 Query: 617 AASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 AA+GS + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 57 AANGSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 111 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/56 (58%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 AS S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 49 ASRSASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 104 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 SR+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 28 SRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 80 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 63.7 bits (148), Expect = 2e-10 Identities = 38/69 (55%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +2 Query: 578 AVGCVTASWRHATAASGSRTRWAAP---SRPASRGGPVPNSPYNESYYNSLAVLLQRPDW 748 A G V AT AS R P RP R NSPY+ESYYNSLAV+LQR DW Sbjct: 321 AAGVVVTRSVTATLASADVRRPGDPLVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDW 378 Query: 749 ENPAVTQLN 775 ENP VTQLN Sbjct: 379 ENPGVTQLN 387 Score = 51.2 bits (117), Expect = 9e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +2 Query: 701 ESYYNSLAVLLQRPDWENPAVTQLN 775 ESYYNSLAV+LQR DWENP VTQLN Sbjct: 254 ESYYNSLAVVLQRRDWENPGVTQLN 278 >SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/51 (62%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = +2 Query: 635 TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 TR +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 30 TRQRSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 80 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 SG + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 11 SGKASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/60 (55%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 H T S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 24 HVTICSYRISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 83 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 63.7 bits (148), Expect = 2e-10 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 10/66 (15%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENP 757 H T + +R R+ S S G P+ NSPY+ESYYNSLAV+LQR DWENP Sbjct: 11 HLTTNAATRVRFPLISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENP 70 Query: 758 AVTQLN 775 VTQLN Sbjct: 71 GVTQLN 76 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = +2 Query: 602 WRHATAASGSRT-RWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVT 766 W + T + ++T +P P P P NSPY+ESYYNSLAV+LQR DWENP VT Sbjct: 24 WSYDTISLATKTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 83 Query: 767 QLN 775 QLN Sbjct: 84 QLN 86 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/61 (54%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R A+ R + P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 76 RQKAASLSRRDSYENPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 135 Query: 773 N 775 N Sbjct: 136 N 136 >SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/62 (51%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 + H+ G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 36 YTHSYLCYGKKEAERSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 95 Query: 770 LN 775 LN Sbjct: 96 LN 97 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 4/57 (7%) Frame = +2 Query: 617 AASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A S R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 11 AGSPFRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 774 LSWVTAGFSQSGRCKRTAS 718 LSWVT GFSQS RCK TAS Sbjct: 193 LSWVTPGFSQSRRCKTTAS 211 >SB_27365| Best HMM Match : PID (HMM E-Value=1.90001e-40) Length = 837 Score = 63.7 bits (148), Expect = 2e-10 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 12/140 (8%) Frame = +1 Query: 271 QW-HADEAAVRAGTCTFPVKYLGCVEVFESRGMQVCEEALKVLR----------NSRRRP 417 QW HA E+ +A + VK+ G EV E++G +V +EA+ ++ ++ Sbjct: 19 QWLHAPESLTQAAVL-YTVKFYGVTEVAEAKGTEVIKEAITKVQFANHIKKSEAGTKASK 77 Query: 418 IRAV-LHVSGDGLRVVEEETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCH 594 +R V L ++ DG+ + + ++K ++ + +S+CA D+ ++R F++I +D T+ + C+ Sbjct: 78 LRKVDLKINIDGVSIEDSKSKEVLHSYPLHHISYCADDKRNKRVFAFIAKDKTSPKHTCY 137 Query: 595 GFLASRDSGERLSHAVGCAF 654 F A R E L+ VG AF Sbjct: 138 VFEAER-LAEELTLTVGQAF 156 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 63.7 bits (148), Expect = 2e-10 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R T+ +++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 9 REKTSKHKAKSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 68 Query: 773 N 775 N Sbjct: 69 N 69 >SB_12554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 W H T P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 31 WPHPTRLETRTKESNIPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 90 Query: 770 LN 775 LN Sbjct: 91 LN 92 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G+ R +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 41 GAFARLESPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 94 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 63.3 bits (147), Expect = 2e-10 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 7/67 (10%) Frame = +2 Query: 596 ASWRHATAASGSRTRWA---APSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWEN 754 A+ R A++ G R R + +P P P P NSPY+ESYYNSLAV+LQR DWEN Sbjct: 7 AASRAASSIVGQRRRESNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWEN 66 Query: 755 PAVTQLN 775 P VTQLN Sbjct: 67 PGVTQLN 73 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPYNESYYNSLAV+LQR DWENP VTQLN Sbjct: 56 NSPYNESYYNSLAVVLQRRDWENPGVTQLN 85 >SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) Length = 120 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPYNESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYNESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 63.3 bits (147), Expect = 2e-10 Identities = 36/66 (54%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +2 Query: 590 VTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENP 757 V S ATA + S + +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 240 VLPSLVRATAINASNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENP 297 Query: 758 AVTQLN 775 VTQLN Sbjct: 298 GVTQLN 303 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 63.3 bits (147), Expect = 2e-10 Identities = 38/73 (52%), Positives = 42/73 (57%), Gaps = 4/73 (5%) Frame = +2 Query: 569 VPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQ 736 +P AV R AAS S +P P P P NSPY+ESYYNSLAV+LQ Sbjct: 7 IPAAVLTPAPVERQHVAASNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQ 62 Query: 737 RPDWENPAVTQLN 775 R DWENP VTQLN Sbjct: 63 RRDWENPGVTQLN 75 >SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 4/50 (8%) Frame = +2 Query: 638 RWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 25 RLACPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 10/64 (15%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAV 763 T G+++ + AP R G P+ NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 9 TLTKGNKSWYRAPPRGRRPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 68 Query: 764 TQLN 775 TQLN Sbjct: 69 TQLN 72 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 62.9 bits (146), Expect = 3e-10 Identities = 35/65 (53%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +2 Query: 593 TASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPA 760 T W A + S S +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 53 TGLWSGALSQSNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 108 Query: 761 VTQLN 775 VTQLN Sbjct: 109 VTQLN 113 >SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) Length = 458 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGP--VPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 ASG +T +R R P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 96 ASGDKTIRIWDARILERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 149 >SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 10/64 (15%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAV 763 T G+++ + AP R G P+ NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 9 TLTKGNKSWYRAPPRGRRPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 68 Query: 764 TQLN 775 TQLN Sbjct: 69 TQLN 72 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 62.9 bits (146), Expect = 3e-10 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 4/84 (4%) Frame = +2 Query: 536 TNEDLVTFVATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNE 703 T +D + +V A+ + SW+ + +P P P P NSPY+E Sbjct: 3 TFDDTLGYVRLAVKALQ-LAVSWQILLQVGFKVSNSCSPGDPLVLERPPPRWSSNSPYSE 61 Query: 704 SYYNSLAVLLQRPDWENPAVTQLN 775 SYYNSLAV+LQR DWENP VTQLN Sbjct: 62 SYYNSLAVVLQRRDWENPGVTQLN 85 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 4/64 (6%) Frame = +2 Query: 596 ASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAV 763 + +R S + + +P P P P NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 54 SKFRRKRRKSSTTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 113 Query: 764 TQLN 775 TQLN Sbjct: 114 TQLN 117 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 62.9 bits (146), Expect = 3e-10 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 4/69 (5%) Frame = +2 Query: 581 VGCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDW 748 +G V H+ S R+ +P P P P NSPY+ESYYNSLAV+LQR DW Sbjct: 542 IGSVEWVEEHSKILS-DRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDW 600 Query: 749 ENPAVTQLN 775 ENP VTQLN Sbjct: 601 ENPGVTQLN 609 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 + +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 2 TSNRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 56 >SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +SPY+ESYYNSLAV+LQRPDWENP VTQLN Sbjct: 48 HSPYSESYYNSLAVVLQRPDWENPGVTQLN 77 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 62.9 bits (146), Expect = 3e-10 Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 5/61 (8%) Frame = +2 Query: 608 HATAASGSR-TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 H S SR + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 43 HKIVKSSSRASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 102 Query: 773 N 775 N Sbjct: 103 N 103 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 62.9 bits (146), Expect = 3e-10 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 10/92 (10%) Frame = +2 Query: 530 EITNEDLVTFVATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPV--------- 682 ++ NED V + + +T + +++PS S G P+ Sbjct: 71 DVDNEDRVVMMMMMIMMTMVMTMVLMMTMVSRNIPDHYSSPSNSCSPGDPLVLERPPPRW 130 Query: 683 -PNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 131 SSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 162 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 23 AYGKTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 78 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 10/57 (17%) Frame = +2 Query: 635 TRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T +A PS S G P+ NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 39 TTYAEPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 95 >SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A+G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 AAGVGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_44042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 10/64 (15%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAV 763 T G+++ + AP R G P+ NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 9 TLTKGNKSWYRAPPRGRRPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 68 Query: 764 TQLN 775 TQLN Sbjct: 69 TQLN 72 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T A ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 8 TCALPQKSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 + +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 22 SKATRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 10/64 (15%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAV 763 T G+++ + AP R G P+ NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 9 TLTKGNKSWYRAPPRGRRPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 68 Query: 764 TQLN 775 TQLN Sbjct: 69 TQLN 72 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 S +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 5 SFARSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 59 >SB_19807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ + P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 26 RSGYTCPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_17580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 10/64 (15%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAV 763 T G+++ + AP R G P+ NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 9 TLTKGNKSWYRAPPRGRRPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 68 Query: 764 TQLN 775 TQLN Sbjct: 69 TQLN 72 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 TA S+ P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 169 TATQMSQEALLCPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 226 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 SG + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 9 SGLTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 62.5 bits (145), Expect = 4e-10 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 W T+ S S RP R NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 74 WGEGTSNSCSPGDPLVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 129 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 9 TRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/51 (60%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = +2 Query: 635 TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 631 TKATSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 681 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 ARSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 62.5 bits (145), Expect = 4e-10 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 S R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 19 SRPRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.5 bits (145), Expect = 4e-10 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T +G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 15 TPNAGGISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 72 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 62.5 bits (145), Expect = 4e-10 Identities = 35/65 (53%), Positives = 40/65 (61%) Frame = +2 Query: 581 VGCVTASWRHATAASGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPA 760 +GC + R T+ S S RP R NSPY+ESYYNSLAV+LQR DWENP Sbjct: 13 IGCFQSQTR-VTSNSCSPGDPLVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPG 69 Query: 761 VTQLN 775 VTQLN Sbjct: 70 VTQLN 74 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.5 bits (145), Expect = 4e-10 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +A G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 10 SANIGKTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 62 ARSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 114 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 62.5 bits (145), Expect = 4e-10 Identities = 39/86 (45%), Positives = 47/86 (54%) Frame = +2 Query: 518 ARPTEITNEDLVTFVATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVPNSPY 697 A PTE + ++T PP G V + + + S RP R NSPY Sbjct: 23 ATPTEFPDTTVIT--DKPPPKKGPVQDEIKISNSCSPGDP--LVLERPPPRWSS--NSPY 76 Query: 698 NESYYNSLAVLLQRPDWENPAVTQLN 775 +ESYYNSLAV+LQR DWENP VTQLN Sbjct: 77 SESYYNSLAVVLQRRDWENPGVTQLN 102 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Frame = +2 Query: 620 ASGSRT-RWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 ASG T +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 474 ASGQTTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 530 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 + R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 22 SKSKRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 62.5 bits (145), Expect = 4e-10 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +ATA S S +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 31 NATAQSNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 86 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 91 ARSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 143 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = +2 Query: 644 AAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A+P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 322 ASPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 369 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 9 TRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 62.5 bits (145), Expect = 4e-10 Identities = 35/63 (55%), Positives = 39/63 (61%), Gaps = 4/63 (6%) Frame = +2 Query: 599 SWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVT 766 S +H A S S +P P P P NSPY+ESYYNSLAV+LQR DWENP VT Sbjct: 49 SLQHVRALSNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 104 Query: 767 QLN 775 QLN Sbjct: 105 QLN 107 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 2 TRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/56 (60%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +2 Query: 623 SGSRT-RWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 SG RT +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 7 SGIRTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 62 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 44 ARSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 96 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 62.5 bits (145), Expect = 4e-10 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A+ R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 318 ANRVRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 373 >SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/65 (52%), Positives = 37/65 (56%), Gaps = 6/65 (9%) Frame = +2 Query: 599 SWRHATAASGSRTR--WAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPA 760 +W G TR P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 83 TWHPEMTYGGEETRNDKITPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 142 Query: 761 VTQLN 775 VTQLN Sbjct: 143 VTQLN 147 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 S++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 SKSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.5 bits (145), Expect = 4e-10 Identities = 35/68 (51%), Positives = 40/68 (58%) Frame = +2 Query: 572 PPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWE 751 PP +G W+ + S S RP R NSPY+ESYYNSLAV+LQR DWE Sbjct: 7 PPVIG--GNEWKLELSNSCSPGDPLVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWE 62 Query: 752 NPAVTQLN 775 NP VTQLN Sbjct: 63 NPGVTQLN 70 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.5 bits (145), Expect = 4e-10 Identities = 32/61 (52%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQL 772 R + R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQL Sbjct: 5 RRSLVTDEIRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQL 64 Query: 773 N 775 N Sbjct: 65 N 65 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +2 Query: 593 TASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPA 760 T R+ GS + +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 53 TTRMRNRITRGGSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 110 Query: 761 VTQLN 775 VTQLN Sbjct: 111 VTQLN 115 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.5 bits (145), Expect = 4e-10 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 4/63 (6%) Frame = +2 Query: 599 SWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVT 766 S + A R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VT Sbjct: 10 SGKGANNGQFERSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 69 Query: 767 QLN 775 QLN Sbjct: 70 QLN 72 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/54 (57%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G+ + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 534 GNASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 587 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 4 GGASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 381 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 432 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 21 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 72 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 62.1 bits (144), Expect = 5e-10 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = +2 Query: 611 ATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A S + + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 11 ANIVSHNTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 69 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +R + P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 306 ARFMYKVPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 358 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 10 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 12 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.1 bits (144), Expect = 5e-10 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 10/58 (17%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +TR PS S G P+ NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 14 KTRKKIPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 71 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 13 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 64 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 875 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 926 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.1 bits (144), Expect = 5e-10 Identities = 33/57 (57%), Positives = 36/57 (63%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 RH + S S RP R NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 16 RHCASNSCSPGDPLVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 70 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +2 Query: 629 SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 S++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 22 SQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 39 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 90 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/48 (64%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = +2 Query: 644 AAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 63 AGPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 110 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 4 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.1 bits (144), Expect = 5e-10 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 13 TGRSACPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 70 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 66 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 117 >SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 62.1 bits (144), Expect = 5e-10 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 AS ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 20 ASSRKSPPRSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 75 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 69 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 120 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 8 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 59 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 6 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 62.1 bits (144), Expect = 5e-10 Identities = 33/65 (50%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = +2 Query: 593 TASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPA 760 T+S+R ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 174 TSSYRPCYTDLVIQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 233 Query: 761 VTQLN 775 VTQLN Sbjct: 234 VTQLN 238 >SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.1 bits (144), Expect = 5e-10 Identities = 35/64 (54%), Positives = 39/64 (60%), Gaps = 4/64 (6%) Frame = +2 Query: 596 ASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAV 763 AS H+ +S R P P P P NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 24 ASLNHSIGSSDGR-----PGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 78 Query: 764 TQLN 775 TQLN Sbjct: 79 TQLN 82 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 8 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 59 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 25 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 20 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 71 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 54 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 105 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 7 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_47452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/48 (64%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = +2 Query: 644 AAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 32 AGPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 79 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 62.1 bits (144), Expect = 5e-10 Identities = 42/102 (41%), Positives = 53/102 (51%), Gaps = 10/102 (9%) Frame = +2 Query: 500 SRRCPSARPTEITNEDLVTFVATVPPAVGCVTASW--RHATAASGSRTRWAA----PSRP 661 S R SA T + + +T P+ + +S R + GS + A+ P P Sbjct: 2372 STRDISAITTLTASSPTPIYTSTTHPSCSFLNSSQSARRGSDTGGSSSAIASNSCSPGDP 2431 Query: 662 ASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 2432 LVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 2473 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 29 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 80 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 44 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 95 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 11 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 62 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 24 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 75 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 17 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 59 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 110 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 62.1 bits (144), Expect = 5e-10 Identities = 41/92 (44%), Positives = 48/92 (52%), Gaps = 12/92 (13%) Frame = +2 Query: 536 TNEDLVTFVATVPPAVGCVTASWRHATAASGSRTRWAA--PSRPASRGGPV--------- 682 +N L FVA G + A+S S+ W PS S G P+ Sbjct: 35 SNTSLSFFVAEDIILQGFTLTNCGDWHASSVSKKDWIVDNPSNSCSPGDPLVLERPPPRW 94 Query: 683 -PNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 95 SSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 126 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 60 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 111 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 5 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 56 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 14 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 62.1 bits (144), Expect = 5e-10 Identities = 35/80 (43%), Positives = 46/80 (57%), Gaps = 4/80 (5%) Frame = +2 Query: 548 LVTFVATVPPAVGCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYN 715 L F+A + A+ ++ + + S + +P P P P NSPY+ESYYN Sbjct: 17 LALFIAVLLSALAVSYCAYWNRQLLNASNS--CSPGDPLVLERPPPRWSSNSPYSESYYN 74 Query: 716 SLAVLLQRPDWENPAVTQLN 775 SLAV+LQR DWENP VTQLN Sbjct: 75 SLAVVLQRRDWENPGVTQLN 94 >SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 62.1 bits (144), Expect = 5e-10 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = +2 Query: 611 ATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A A ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 42 AIEAEEGQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 100 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 55 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 106 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 54 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 105 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.1 bits (144), Expect = 5e-10 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = +2 Query: 611 ATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A A+ + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 11 ANIANAKVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 69 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 31 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 82 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 214 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 265 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 19 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 70 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 1 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 5 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 56 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/52 (59%), Positives = 35/52 (67%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R+ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 35 RSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 86 >SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/54 (57%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 2 GLQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = +2 Query: 614 TAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T + + + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 8 TEINSTASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Frame = +2 Query: 647 APSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 22 SPGEPLVLERPPPPWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 W S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 49 WPLLIVVPSSISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 108 Query: 770 LN 775 LN Sbjct: 109 LN 110 >SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/51 (62%), Positives = 34/51 (66%), Gaps = 4/51 (7%) Frame = +2 Query: 635 TRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 T A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 290 TSAAHPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 340 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 61.7 bits (143), Expect = 6e-10 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +2 Query: 590 VTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENP 757 ++A+ H A S + +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 9 ISANIPHELLAPTSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENP 66 Query: 758 AVTQLN 775 VTQLN Sbjct: 67 GVTQLN 72 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 4/66 (6%) Frame = +2 Query: 590 VTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENP 757 ++A+ R T + ++ +P P P P NSPY+ESYYNSLAV+LQR DWENP Sbjct: 9 ISANIRRPTIQA-RKSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENP 67 Query: 758 AVTQLN 775 VTQLN Sbjct: 68 GVTQLN 73 >SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 31 GDGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 84 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 134 GGPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 187 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 15 GHSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/48 (64%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = +2 Query: 644 AAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 1899 AIPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 1946 >SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 61.7 bits (143), Expect = 6e-10 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 H T S S +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 HGTYGSNS----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 61.7 bits (143), Expect = 6e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 86 NSPYSESYYNSLAVILQRRDWENPGVTQLN 115 >SB_49651| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) Length = 342 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/51 (60%), Positives = 33/51 (64%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 SG RP R NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 231 SGDGVTCVVLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 279 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 4/49 (8%) Frame = +2 Query: 641 WAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 40 YVSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 88 >SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) Length = 162 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/57 (57%), Positives = 36/57 (63%) Frame = +2 Query: 605 RHATAASGSRTRWAAPSRPASRGGPVPNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 RH+T G RP R NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 38 RHSTTRPGDPL---VLERPPPRWSS--NSPYSESYYNSLAVVLQRRDWENPGVTQLN 89 >SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/48 (64%), Positives = 33/48 (68%), Gaps = 4/48 (8%) Frame = +2 Query: 644 AAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 236 ARPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 283 >SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) Length = 390 Score = 61.7 bits (143), Expect = 6e-10 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 13/59 (22%) Frame = +2 Query: 638 RWAAPSRPA---SRGGPV----------PNSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 RWA PSR S G P+ NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 88 RWAWPSRDKVIDSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 146 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 13 GELSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 66 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 S S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 88 SVSTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 142 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +2 Query: 620 ASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A+ S + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 2 AAISASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 61.7 bits (143), Expect = 6e-10 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 4/68 (5%) Frame = +2 Query: 584 GCVTASWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWE 751 G + A R + GS + +P P P P NSPY+ESYYNSLAV+LQR DWE Sbjct: 12 GGLRAVRRDCCRSRGSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWE 69 Query: 752 NPAVTQLN 775 NP VTQLN Sbjct: 70 NPGVTQLN 77 >SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 4 GDGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +2 Query: 608 HATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 ++ A GS + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 37 YSRANKGSNS--CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 94 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 623 SGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 +G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 107 NGFTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 161 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 5/64 (7%) Frame = +2 Query: 599 SWRHATAASG-SRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAV 763 SW A +++ +P P P P NSPY+ESYYNSLAV+LQR DWENP V Sbjct: 16 SWYRAPPRGRRAKSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 75 Query: 764 TQLN 775 TQLN Sbjct: 76 TQLN 79 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/54 (57%), Positives = 35/54 (64%), Gaps = 4/54 (7%) Frame = +2 Query: 626 GSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 G + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 17 GPASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 70 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/63 (50%), Positives = 40/63 (63%), Gaps = 4/63 (6%) Frame = +2 Query: 599 SWRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVT 766 +W++A + + +P P P P NSPY+ESYYNSLAV+LQR DWENP VT Sbjct: 13 TWKYAIDIASNS---CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 69 Query: 767 QLN 775 QLN Sbjct: 70 QLN 72 >SB_8768| Best HMM Match : TrmB (HMM E-Value=0.86) Length = 480 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/69 (47%), Positives = 40/69 (57%), Gaps = 6/69 (8%) Frame = +2 Query: 587 CVTASWRHATAASGSRTR--WAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDW 748 C+ A + G+ + +P P P P NSPY+ESYYNSLAV+LQR DW Sbjct: 339 CLNARLKSQVYVKGANLANIFTSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDW 398 Query: 749 ENPAVTQLN 775 ENP VTQLN Sbjct: 399 ENPGVTQLN 407 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 61.7 bits (143), Expect = 6e-10 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Frame = +2 Query: 611 ATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 A A + + + +P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 186 AVAVAVAVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 244 >SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +2 Query: 602 WRHATAASGSRTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQ 769 W H + R P P P P NSPY+ESYYNSLAV+LQR DWENP VTQ Sbjct: 5 WGHLFSLLAERPE--VPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 62 Query: 770 LN 775 LN Sbjct: 63 LN 64 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 61.7 bits (143), Expect = 6e-10 Identities = 31/52 (59%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Frame = +2 Query: 632 RTRWAAPSRPASRGGPVP----NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 R + P P P P NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 31 RIEFLQPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 82 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 33 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 62 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 85 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 47 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 205 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 234 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 370 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 399 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 27 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 56 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 329 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 358 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 69 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 98 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 123 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 152 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 81 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 85 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 245 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 274 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 103 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 132 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 385 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 414 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 108 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 137 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 64 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 81 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 174 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 203 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 73 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 102 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 104 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.3 bits (142), Expect = 9e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 686 NSPYNESYYNSLAVLLQRPDWENPAVTQLN 775 NSPY+ESYYNSLAV+LQR DWENP VTQLN Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,180,789 Number of Sequences: 59808 Number of extensions: 423585 Number of successful extensions: 4167 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4162 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -