BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0060 (779 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01730.1 68415.m00101 metallo-beta-lactamase family protein s... 29 3.5 At4g14990.1 68417.m02303 expressed protein 29 4.6 >At2g01730.1 68415.m00101 metallo-beta-lactamase family protein simliar to SP|P79101 Cleavage and polyadenylation specificity factor, 73 kDa subunit (CPSF 73 kDa subunit) {Bos taurus}; contains Pfam profile PF00753: Metallo-beta-lactamase superfamily Length = 613 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 403 SRRRPIRAVLHVSGDGLRVVEEETKGLIVDQTIEKVSFCAPDRNHERGFSYIC 561 S +R H + DG+ V+E+ K IV Q +++S ++NH ++ C Sbjct: 472 SNSTQLRVTDHRTADGVLVIEKSKKAKIVHQ--DEISEVLHEKNHVVSLAHCC 522 >At4g14990.1 68417.m02303 expressed protein Length = 787 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 337 CVEVFESRGMQVCEEALKVLRNSRRRPIRAVLHVSGDGLRVV 462 CV+ + R + C A V+ +S + P+R + SGDG VV Sbjct: 623 CVQAMDLRALSACLAA--VVCSSEQPPLRPIGSSSGDGASVV 662 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,041,031 Number of Sequences: 28952 Number of extensions: 279274 Number of successful extensions: 861 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -