BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0058 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 25 0.73 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.7 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.0 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 25.0 bits (52), Expect = 0.73 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 631 NCWITHIKYHR*LTIFQSKYVHSTC*SLTPAVKE 530 +CW+ K+H + + V+ T LT VKE Sbjct: 120 SCWLQMTKHHNFIKVCSVNDVNMTITELTDPVKE 153 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 640 LSTKTSALIITIKYYLISQIKPTNFKLL 723 L+ S+L T+KYY + P NFK + Sbjct: 297 LTEAYSSLENTLKYYEVGSNVPFNFKFI 324 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 55 WNEVPYGTMRRGTLN 11 W P+G MRR LN Sbjct: 176 WIWTPHGWMRRNVLN 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,863 Number of Sequences: 438 Number of extensions: 4372 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -