BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0056 (481 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-3326|AAF53952.1| 799|Drosophila melanogaster CG1762-PA... 28 5.8 AE013599-3804|AAF47157.1| 537|Drosophila melanogaster CG3209-PA... 28 7.6 >AE014134-3326|AAF53952.1| 799|Drosophila melanogaster CG1762-PA protein. Length = 799 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +1 Query: 10 NFYVFRSIGHSNFLMIFTPVTF*LHDYVILVIYFS 114 +F+V++ I HSNFL I V DYV LV Y S Sbjct: 698 SFFVYQVIDHSNFLTI-QAVDCEPPDYVALVGYIS 731 >AE013599-3804|AAF47157.1| 537|Drosophila melanogaster CG3209-PA, isoform A protein. Length = 537 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = +1 Query: 259 IFVYFVMNIIF*PINMQLCYLGVKTALIRSYLI 357 +F +F+ +I P+ + +C++GV A++ S ++ Sbjct: 173 VFGFFIRYVILMPLRVLVCFVGVLFAVLSSSIV 205 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,981,012 Number of Sequences: 53049 Number of extensions: 373218 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1663799760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -