BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0056 (481 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49740.1 68416.m05438 pentatricopeptide (PPR) repeat-containi... 27 5.0 >At3g49740.1 68416.m05438 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 737 Score = 27.5 bits (58), Expect = 5.0 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +3 Query: 27 INRTFEFPNDFYSSDVLITRLCYFSDLFFGDCVRCVIVNIGT*TQAHVYDLL 182 ++R D YS + IT + D FG V C + G +HV + L Sbjct: 47 VHRCTTLRPDQYSVSLAITTARHLRDTIFGGQVHCYAIRSGLLCHSHVSNTL 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,638,414 Number of Sequences: 28952 Number of extensions: 178173 Number of successful extensions: 363 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 819227264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -