BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0054 (741 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.85 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.85 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 7.9 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 7.9 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 24.6 bits (51), Expect = 0.85 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 413 IIFGYLLACLVYGKDVTLSIG 351 I FGYL++C+ + LSIG Sbjct: 541 ISFGYLISCVSRSVSMALSIG 561 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.6 bits (51), Expect = 0.85 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 413 IIFGYLLACLVYGKDVTLSIG 351 I FGYL++C+ + LSIG Sbjct: 541 ISFGYLISCVSRSVSMALSIG 561 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +1 Query: 463 CWRILQNCLIYF 498 CW +L NC+ F Sbjct: 1124 CWNVLLNCVYLF 1135 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 591 YSDLNQMYDSKDVNVYHLLSGYRGLDVSKIFEFQLI 698 Y++L ++ ++ + HLLSG LD+ QL+ Sbjct: 187 YTNLLRIIEADFSKLNHLLSGTENLDLVLPIYSQLV 222 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 366 HVLPVYKTCEQIAKDNIHDYIT 431 H+L + TC QI + Y T Sbjct: 327 HILSIVNTCSQIPSEVEDKYTT 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,651 Number of Sequences: 336 Number of extensions: 4557 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -