BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0053 (418 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces... 132 2e-32 SPCC1020.09 |||WD repeat protein, human WDR79 family|Schizosacch... 27 1.2 SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo... 27 1.5 SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr... 25 4.7 SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr 2|... 24 8.2 >SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces pombe|chr 1|||Manual Length = 195 Score = 132 bits (319), Expect = 2e-32 Identities = 66/126 (52%), Positives = 93/126 (73%), Gaps = 2/126 (1%) Frame = +3 Query: 9 KIIKASGAEADSFETSISQALVELETNS-DLKAQLRELYITKAKEIELHN-KKSIIIYVP 182 KI+K S ++ + ++Q L +LE++S D+ +LR L IT A+E+E+ KK+I+++VP Sbjct: 6 KIVKRSSSQPTETDLLVAQCLYDLESSSKDMAKELRPLQITSAREVEVGGGKKAIVVFVP 65 Query: 183 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 362 P LKAF K Q RL RELEKKF+ +HV+F+ R+ILPKP K+RV QKRPRSRTLT+V Sbjct: 66 QPLLKAFHKCQARLTRELEKKFADRHVIFIAQRRILPKPGRKSRVT--QKRPRSRTLTAV 123 Query: 363 YDAILE 380 ++AILE Sbjct: 124 HNAILE 129 >SPCC1020.09 |||WD repeat protein, human WDR79 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 399 Score = 27.1 bits (57), Expect = 1.2 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -1 Query: 301 LGLGRILRSPTKTTCLPLNFFSSSRTS 221 LG I +SPTK PLNFF SSR S Sbjct: 33 LGTNVIAQSPTK----PLNFFHSSRWS 55 >SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 26.6 bits (56), Expect = 1.5 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +3 Query: 171 IYVPMPKLKAFQKIQIRLVRELEKKFSGKHV 263 +++P K F+KI+ +VRE E+K +GK+V Sbjct: 101 LHLPGQKFFEFEKIREEIVRETEEK-TGKNV 130 >SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 25.0 bits (52), Expect = 4.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -3 Query: 347 P*AWPLLFVSNTSFVAGLRQDLTVSN 270 P A +LF+S TSF++G+ Q + ++N Sbjct: 373 PPAAMILFISCTSFISGILQLVLLNN 398 >SPBC12C2.08 |dnm1||dynamin Dnm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 781 Score = 24.2 bits (50), Expect = 8.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 260 MFTTELLFELTDKPDLNLL 204 +F +E+ F++ KP LNLL Sbjct: 436 LFLSEMAFDILVKPQLNLL 454 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,681,739 Number of Sequences: 5004 Number of extensions: 32210 Number of successful extensions: 108 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -