BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0053 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 157 5e-39 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.38 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 1.2 SB_41705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) 29 2.0 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 2.7 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 2.7 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 3.6 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 4.7 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 4.7 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_54694| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 27 6.2 SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_4809| Best HMM Match : SRF-TF (HMM E-Value=5.5) 27 8.2 SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 27 8.2 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 157 bits (380), Expect = 5e-39 Identities = 76/114 (66%), Positives = 94/114 (82%) Frame = +3 Query: 3 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 182 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 183 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 344 +P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 68 VPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.38 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +3 Query: 87 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 251 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 252 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 344 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.5 bits (63), Expect = 1.2 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 5/111 (4%) Frame = +3 Query: 12 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 179 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 180 PMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQ 329 M KL++ Q ELEK+ ++ ++I P K S T VA + Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENE 1779 >SB_41705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.7 bits (61), Expect = 2.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 258 HVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILEGGPGTQFAL 407 H V DR+ LP +V +++ + R + VY +LE G G+Q + Sbjct: 84 HDPLVRDRRALPPSRSADQVTDREAIDQCRDILGVYSGVLEKG-GSQLMI 132 >SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) Length = 237 Score = 28.7 bits (61), Expect = 2.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 326 FVSNTSFVAGLRQDLTVSNKDYMFTTE 246 F+ N SFV+ + DLT S+ D+ + TE Sbjct: 40 FIPNLSFVSAVLWDLTKSSSDFQWHTE 66 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 2.7 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 39 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 206 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 91 PTSKPNFGSFTLQKLKKLNYTIRS 162 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 296 LRQDLTVSNKDYMFTTELLFELTDKPDLNLLKGLQFRHRHIDDDRLL 156 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 4.7 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +1 Query: 70 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 168 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 344 KDIDLCVRCYPRGGARYPIRP 406 +D+ +C C P GG R P+ P Sbjct: 620 QDMTICSACAPPGGGRNPVTP 640 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +3 Query: 177 VPMPKLKAFQKIQIRLVRELEKKFSG 254 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.5 bits (58), Expect = 4.7 Identities = 20/101 (19%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = +3 Query: 30 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 194 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 195 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHK 308 + + + +RE+E++F K+ + +R++ + K Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKK 337 >SB_54694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 291 PKPSHKTRVANKQKRPRSRTLTSVYDAILEGGPGTQF 401 P P +++ V N RP +R+ + YD + +GG TQ+ Sbjct: 43 PVPQYES-VNNAPVRPPNRSNVTQYDDVTQGGNVTQY 78 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 27.1 bits (57), Expect = 6.2 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 296 LRQDLTVSNKDYMFTTELLFELTDKPDLNLLKGLQFRHRHIDDDRLL 156 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 40 LRQRLNSSNPGISNPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 86 >SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 306 KTRVANKQKRPRSRTLTSVYDAILEGGPGT 395 +T+++N KRPR R ++ + I GPGT Sbjct: 255 ETKISNT-KRPRHRHISLCQETITRHGPGT 283 >SB_4809| Best HMM Match : SRF-TF (HMM E-Value=5.5) Length = 311 Score = 26.6 bits (56), Expect = 8.2 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 6/89 (6%) Frame = +3 Query: 87 NSDLKAQLREL-YITKAKEIELHNKKSIIIYVP--MPKLKAFQKIQIRLVRELEKKFSGK 257 N K +R + YI K E+ K+ +++ M +++ + +L+ + + Sbjct: 51 NKAKKGVIRTVGYINKGNEVISTKKRKLLMKHSRDMLEVQVISTKKRKLLMKHSRDMLEV 110 Query: 258 HVVFVGDRKILPKPSH---KTRVANKQKR 335 V+F+ +RK+L K SH K +V +KR Sbjct: 111 QVIFIKERKLLTKHSHDLVKVQVIFTKKR 139 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 26.6 bits (56), Expect = 8.2 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 296 LRQDLTVSNKDYMFTTELLFELTDKPDLNLLKGLQFRHRHIDDDRLL 156 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 40 LRQRLNSSNPSKSNPINILDALCQKHDIAYSKSKDLDDKHLADDNLL 86 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +3 Query: 177 VPMPKLKAFQKIQIRLVRELEKKFSG 254 VP+P+++A QK++ L R +E+K +G Sbjct: 190 VPLPQVRAMQKVKGEL-RNMEQKLNG 214 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,843,666 Number of Sequences: 59808 Number of extensions: 248799 Number of successful extensions: 810 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -