BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0052 (606 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak... 27 1.6 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 2.8 SPAC2F3.09 |hem1||5-aminolevulinate synthase|Schizosaccharomyces... 25 6.5 SPBC2F12.14c |gua1||IMP dehydrogenase Gua1 |Schizosaccharomyces ... 25 8.6 >SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 708 Score = 27.5 bits (58), Expect = 1.6 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +1 Query: 535 KALCILKCLL-FKTDDLCLKKNEK 603 +A CI+K L F TDDL +K NEK Sbjct: 612 EADCIIKNLQNFSTDDLIIKSNEK 635 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 26.6 bits (56), Expect = 2.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 517 FIYWCHKALCILKCLLFKTDDLCLKK 594 F +WC L I CLL + +CL+K Sbjct: 1281 FGFWCVTVLTIALCLLPRFSYICLQK 1306 >SPAC2F3.09 |hem1||5-aminolevulinate synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 325 LDTGVALCRHANAVRDSAKLILDAP 399 ++TG CRHA+AV+ +A+ P Sbjct: 82 VNTGSRTCRHADAVKAAAEAATTTP 106 >SPBC2F12.14c |gua1||IMP dehydrogenase Gua1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 524 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = +1 Query: 256 DLAEWLTVLYPELRITADNFLDRLDTGVALCRHANAVR 369 ++ +W+ YP++ + A N + R T + A+ +R Sbjct: 291 EMIKWIKKTYPKIDVIAGNVVTREQTASLIAAGADGLR 328 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,339,118 Number of Sequences: 5004 Number of extensions: 44849 Number of successful extensions: 137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -