BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0049 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 386 e-107 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 30 1.5 SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 4.7 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 386 bits (949), Expect = e-107 Identities = 171/230 (74%), Positives = 200/230 (86%) Frame = +1 Query: 1 KRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRL 180 KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G EV KIVKQRL Sbjct: 434 KRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEVKKIVKQRL 493 Query: 181 IKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRV 360 IK+DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V+RV Sbjct: 494 IKIDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRV 553 Query: 361 ATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNLCMITGGRNL 540 G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ M+ GGRN+ Sbjct: 554 DVGAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGGRNM 613 Query: 541 GRVGTIVSRERHPGSFDIVHIKDSTGHTFSTRLNNVFIIGKGTKAYISLP 690 GRVG + RE+H GSFDIVH+KD+TGH F+TRL N+F+IGKG K Y+SLP Sbjct: 614 GRVGMVTHREKHAGSFDIVHVKDATGHQFATRLTNIFVIGKGNKPYVSLP 663 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +1 Query: 304 IHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIM 483 I +TP+ K C+V R++TGP +++ +G + +++ ++ + + + Sbjct: 287 IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMGSEGTLGVITEVTLRIRPVPEIRVYGSVV- 345 Query: 484 DFIKFESGNLCM 519 F FE G CM Sbjct: 346 -FPDFEKGVACM 356 >SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1776 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/56 (19%), Positives = 28/56 (50%) Frame = +1 Query: 130 KYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 297 +Y L ++ + + L++ G + P+YP+ ++ ++ +N+LF + R Sbjct: 596 EYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +3 Query: 117 EES--SEVCFDRKRSPENCE 170 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -3 Query: 194 PSTFMRRCFTIFRTSFPVKAYFRRFLRK------ITRGKHSRNLW 78 PS++ F +FRT FP + RF R+ IT ++LW Sbjct: 84 PSSYNGHQFLVFRTDFPFSKHKNRFKRRTKYLYVITTSTKHQHLW 128 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +1 Query: 322 EEAKYKLCKVKRVATGPKNVPYLVTHDG---RTIRYPDPLIKVNDSIQLDIATTKIMDFI 492 E+A +C++ R+ P+ LV G +++ I + Q+ + + + Sbjct: 2971 EDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDM 3030 Query: 493 KFESGNLCMITGGRNLGRV 549 K + NLC G +N+G V Sbjct: 3031 KLDLANLCTKAGLKNIGTV 3049 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,569,618 Number of Sequences: 59808 Number of extensions: 556446 Number of successful extensions: 1688 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1683 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -