BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0043 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 40 0.002 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 37 0.020 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 36 0.027 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 36 0.027 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 36 0.036 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 36 0.036 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 36 0.036 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 36 0.036 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 36 0.036 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 36 0.036 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 36 0.036 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 36 0.036 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 36 0.036 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 36 0.036 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 36 0.036 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 36 0.036 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31687| Best HMM Match : DUF420 (HMM E-Value=6.3) 30 2.3 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 29 3.1 SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 29 4.1 SB_42191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 28 9.5 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAAD 76 AAALELVDPPGCRNS AAD Sbjct: 10 AAALELVDPPGCRNSIAAD 28 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVT 85 AAALELVDPPGCRNS PV+ Sbjct: 97 AAALELVDPPGCRNSITGGPVS 118 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVTR 88 AAALELVDPPGCRNS + V R Sbjct: 47 AAALELVDPPGCRNSINIESVNR 69 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAAD 76 AAALELVDPPGCRNS D Sbjct: 10 AAALELVDPPGCRNSITKD 28 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVTRTF 94 AAALELVDPPGCRNS A + + Sbjct: 10 AAALELVDPPGCRNSMVASELMEIY 34 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 20 AAALELVDPPGCRNSAA 70 AAALELVDPPGCRNS A Sbjct: 10 AAALELVDPPGCRNSIA 26 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPV 82 AAALELVDPPGCRNS A V Sbjct: 10 AAALELVDPPGCRNSIQARSV 30 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVTRTFRSCRT 109 AAALELVDPPGCRNS + F +T Sbjct: 10 AAALELVDPPGCRNSIRSTTTITIFTIIKT 39 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 20 AAALELVDPPGCRNSAA 70 AAALELVDPPGCRNS A Sbjct: 86 AAALELVDPPGCRNSIA 102 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVTRTF 94 AAALELVDPPGCRNS + + + F Sbjct: 10 AAALELVDPPGCRNSIDINDMKQLF 34 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAAD 76 AAALELVDPPGCRNS A+ Sbjct: 10 AAALELVDPPGCRNSMNAN 28 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVT 85 AAALELVDPPGCRNS + T Sbjct: 10 AAALELVDPPGCRNSIGQNGFT 31 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADP 79 AAALELVDPPGCRNS P Sbjct: 30 AAALELVDPPGCRNSMPDRP 49 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAA 73 AAALELVDPPGCRNS ++ Sbjct: 654 AAALELVDPPGCRNSISS 671 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 36.3 bits (80), Expect = 0.027 Identities = 21/32 (65%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 20 AAALELVDPPGCRNS---AAADPVTRTFRSCR 106 AAALELVDPPGCRNS AAA TF+ R Sbjct: 10 AAALELVDPPGCRNSIHEAAALDGAGTFQRFR 41 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +2 Query: 20 AAALELVDPPGCRNSAAADPVT 85 AAALELVDPPGCRNS + V+ Sbjct: 27 AAALELVDPPGCRNSIDGNGVS 48 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 86 AAALELVDPPGCRNS 100 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 27 AAALELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 67 AAALELVDPPGCRNS 81 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 65 AAALELVDPPGCRNS 79 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 97 AAALELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 73 AAALELVDPPGCRNS 87 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.9 bits (79), Expect = 0.036 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 20 AAALELVDPPGCRNS 64 AAALELVDPPGCRNS Sbjct: 10 AAALELVDPPGCRNS 24 >SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -1 Query: 102 HDLKVLVTGSAAAEFLQPGGSTXXXXXXXRW 10 + L VL G EFLQPGGST RW Sbjct: 3 YGLIVLTVGEKGIEFLQPGGSTSSRAATPRW 33 >SB_31687| Best HMM Match : DUF420 (HMM E-Value=6.3) Length = 349 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 331 CRHFTRIIFRLYVCFRFDLLAIRNC*VVLIRIWIGEIFLYLL 206 C +++ ++FR V FR +++ V WI +FLYL+ Sbjct: 88 CAYYSAVVFRACVIFRLIRGSVQRFEFVNFTHWIFSLFLYLI 129 >SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 96 LKVLVTGSAAAEFLQPGGST 37 ++V V G + EFLQPGGST Sbjct: 1 MEVTVLGKSGLEFLQPGGST 20 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 32 ELVDPPGCRNS 64 ELVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 121 RLRTFSLASQHWYVTCSVAVTPSSYTLRTVGTKI 222 R FS ++H Y+ C V VTP + TL++ T + Sbjct: 826 RATPFSPGTRHLYLPCQVNVTPGNNTLQSRHTTL 859 >SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 84 VTGSAAAEFLQPGGST 37 V G+ A EFLQPGGST Sbjct: 3 VNGAGAIEFLQPGGST 18 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 108 VRHDLKVLVTGSAAAEFLQPGGST 37 ++ D +TG+ EFLQPGGST Sbjct: 12 IQRDYCPFLTGTRLIEFLQPGGST 35 >SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 96 LKVLVTGSAAAEFLQPGGST 37 + + V GS EFLQPGGST Sbjct: 1 MTITVVGSLLIEFLQPGGST 20 >SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) Length = 247 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 96 LKVLVTGSAAAEFLQPGGST 37 + V GSA EFLQPGGST Sbjct: 114 IPVFKKGSALIEFLQPGGST 133 >SB_42191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 175 AVTPSSYTLRTVGTKIFHLSKYELILLNNYVLRGGRNENTHTSG 306 AV + T+ +FH K+ +I L + ++R N T TSG Sbjct: 53 AVNGALLTVVDTDFTLFHDPKFSIISLRSEIVRNSENRPTETSG 96 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 93 KVLVTGSAAAEFLQPGGST 37 K+L +G EFLQPGGST Sbjct: 17 KLLTSGKRYIEFLQPGGST 35 >SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 108 VRHDLKVLVTGSAAAEFLQPGGST 37 ++H L++ + EFLQPGGST Sbjct: 1 MKHFTDTLISANIVIEFLQPGGST 24 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +2 Query: 227 TYPNTN*YYLTITYCEEVETKTHIQAEYDTCKMATQRATSPNIILLTANHTKVN*LGVL 403 T+ TN Y+ T +E+E + +YD K+ +R S N L+ N + +L Sbjct: 2270 THEETN--YVMATNVQEIEAAPELPDDYDAVKLDNERLQSENNNLIGKLKNNENTINIL 2326 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 102 HDLKVLVTGSAAAEFLQPGGST 37 H L L+ EFLQPGGST Sbjct: 79 HPLTTLLDSMRGIEFLQPGGST 100 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 108 VRHDLKVLVTGSAAAEFLQPGGST 37 ++H L++ + EFLQPGGST Sbjct: 1 MKHFTDTLISANIFIEFLQPGGST 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,083,472 Number of Sequences: 59808 Number of extensions: 437587 Number of successful extensions: 1443 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -