BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0042 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 26 6.7 SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.9 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.8 bits (54), Expect = 6.7 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +2 Query: 92 QITK*NRKMPRGKFTNHKGRNRKFTSPEELEEQRKHDEQKKKWRKE 229 Q+ K R++ G F + T+ ++ ++ RK E +KW++E Sbjct: 621 QVVKKRRRLEDGSFEEYLDYLFPDTATDQGDKMRKMLELSRKWKEE 666 >SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 167 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 173 EELEEQRKHDEQKKKWRKEQ 232 + L+EQR+ EQKK+ +KE+ Sbjct: 138 QRLKEQREKKEQKKEQKKEK 157 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,926,212 Number of Sequences: 5004 Number of extensions: 25815 Number of successful extensions: 94 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -