BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0042 (762 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060986-1|AAL28534.1| 215|Drosophila melanogaster GM14292p pro... 52 1e-06 AE014298-642|AAF45957.1| 215|Drosophila melanogaster CG11444-PA... 52 1e-06 BT024370-1|ABC86432.1| 189|Drosophila melanogaster IP07252p pro... 46 7e-05 AE014134-1632|AAF52770.1| 189|Drosophila melanogaster CG4438-PA... 46 7e-05 BT016134-1|AAV37019.1| 568|Drosophila melanogaster GH11784p pro... 29 9.2 AE014297-2463|AAF55511.1| 568|Drosophila melanogaster CG7183-PA... 29 9.2 >AY060986-1|AAL28534.1| 215|Drosophila melanogaster GM14292p protein. Length = 215 Score = 51.6 bits (118), Expect = 1e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 116 MPRGKFTNHKGRNRKFTSPEELEEQRKHDEQK 211 MPRGKF NHKGR+R FTSPEEL+++ + D + Sbjct: 1 MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQ 32 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 329 KGVSGLIEVENPNRV 373 KGV+ LIE+ENPNRV Sbjct: 106 KGVASLIEIENPNRV 120 >AE014298-642|AAF45957.1| 215|Drosophila melanogaster CG11444-PA protein. Length = 215 Score = 51.6 bits (118), Expect = 1e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 116 MPRGKFTNHKGRNRKFTSPEELEEQRKHDEQK 211 MPRGKF NHKGR+R FTSPEEL+++ + D + Sbjct: 1 MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQ 32 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 329 KGVSGLIEVENPNRV 373 KGV+ LIE+ENPNRV Sbjct: 106 KGVASLIEIENPNRV 120 >BT024370-1|ABC86432.1| 189|Drosophila melanogaster IP07252p protein. Length = 189 Score = 45.6 bits (103), Expect = 7e-05 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = +2 Query: 116 MPRGKFTNHKGRNRKFTSPEELEEQRKHD 202 MPRGKF ++KGR R+FTSPEEL ++ + D Sbjct: 1 MPRGKFLSYKGRTRQFTSPEELRQESEDD 29 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +2 Query: 329 KGVSGLIEVENPNRV 373 KGV+ LIE++NPNRV Sbjct: 92 KGVASLIEIDNPNRV 106 >AE014134-1632|AAF52770.1| 189|Drosophila melanogaster CG4438-PA protein. Length = 189 Score = 45.6 bits (103), Expect = 7e-05 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = +2 Query: 116 MPRGKFTNHKGRNRKFTSPEELEEQRKHD 202 MPRGKF ++KGR R+FTSPEEL ++ + D Sbjct: 1 MPRGKFLSYKGRTRQFTSPEELRQESEDD 29 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +2 Query: 329 KGVSGLIEVENPNRV 373 KGV+ LIE++NPNRV Sbjct: 92 KGVASLIEIDNPNRV 106 >BT016134-1|AAV37019.1| 568|Drosophila melanogaster GH11784p protein. Length = 568 Score = 28.7 bits (61), Expect = 9.2 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 9/51 (17%) Frame = +2 Query: 107 NRKMPRGKFTNHKGRNRKFTSP--------EELEEQRKHDEQKKKW-RKEQ 232 N K R +NH + F P E L KHDEQ+ W RKEQ Sbjct: 201 NTKGSRELNSNHNSDDESFIGPRPTESVFSEALSTMTKHDEQRMNWERKEQ 251 >AE014297-2463|AAF55511.1| 568|Drosophila melanogaster CG7183-PA protein. Length = 568 Score = 28.7 bits (61), Expect = 9.2 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 9/51 (17%) Frame = +2 Query: 107 NRKMPRGKFTNHKGRNRKFTSP--------EELEEQRKHDEQKKKW-RKEQ 232 N K R +NH + F P E L KHDEQ+ W RKEQ Sbjct: 201 NTKGSRELNSNHNSDDESFIGPRPTESVFSEALSTMTKHDEQRMNWERKEQ 251 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,607,715 Number of Sequences: 53049 Number of extensions: 261844 Number of successful extensions: 856 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3499501170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -