BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0041 (724 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72510-6|CAM84693.1| 2892|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z72510-5|CAM84692.1| 3095|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z72507-18|CAM84805.1| 2892|Caenorhabditis elegans Hypothetical p... 29 3.4 Z72507-17|CAM84804.1| 3095|Caenorhabditis elegans Hypothetical p... 29 3.4 >Z72510-6|CAM84693.1| 2892|Caenorhabditis elegans Hypothetical protein F53B7.5b protein. Length = 2892 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 470 KKKNRTPQILKKTSIHLIVKLFF*LKFCSWY 378 K+KNR P + + TSI ++ +LFF L F S++ Sbjct: 10 KRKNRRPTVYQGTSI-ILSQLFFLLLFSSYF 39 >Z72510-5|CAM84692.1| 3095|Caenorhabditis elegans Hypothetical protein F53B7.5a protein. Length = 3095 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 470 KKKNRTPQILKKTSIHLIVKLFF*LKFCSWY 378 K+KNR P + + TSI ++ +LFF L F S++ Sbjct: 10 KRKNRRPTVYQGTSI-ILSQLFFLLLFSSYF 39 >Z72507-18|CAM84805.1| 2892|Caenorhabditis elegans Hypothetical protein F53B7.5b protein. Length = 2892 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 470 KKKNRTPQILKKTSIHLIVKLFF*LKFCSWY 378 K+KNR P + + TSI ++ +LFF L F S++ Sbjct: 10 KRKNRRPTVYQGTSI-ILSQLFFLLLFSSYF 39 >Z72507-17|CAM84804.1| 3095|Caenorhabditis elegans Hypothetical protein F53B7.5a protein. Length = 3095 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -3 Query: 470 KKKNRTPQILKKTSIHLIVKLFF*LKFCSWY 378 K+KNR P + + TSI ++ +LFF L F S++ Sbjct: 10 KRKNRRPTVYQGTSI-ILSQLFFLLLFSSYF 39 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,071,944 Number of Sequences: 27780 Number of extensions: 365186 Number of successful extensions: 812 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -