BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0039 (826 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g32030.1 68416.m04070 terpene synthase/cyclase family protein... 30 1.6 At4g29280.1 68417.m04186 expressed protein ; expression supporte... 29 3.7 At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing pro... 29 5.0 At4g20730.1 68417.m03013 filament protein-related similar to Cyt... 29 5.0 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 29 5.0 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 28 8.7 >At3g32030.1 68416.m04070 terpene synthase/cyclase family protein contains Pfam profile: PF01397 terpene synthase family Length = 604 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 6 FLNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRA 128 +L+ ++L+ S LF LSLK +HDFV V++ T++ Sbjct: 15 YLHQAPLFLKTSQS--LFPRPSLSLKPMKHDFVCVKATTKS 53 >At4g29280.1 68417.m04186 expressed protein ; expression supported by MPSS Length = 77 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 244 CMCEVYPGGVCNPSFCVCV*YRLKNGAG 327 C ++PG C+PS CV Y NG G Sbjct: 31 CTIIIHPGSPCDPSDCVQYCYAEYNGVG 58 >At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing protein similar to meiotic asynaptic mutant 1 [Arabidopsis thaliana] GI:7939627, aysnaptic 1 [Brassica oleracea var. alboglabra] GI:23506946; contains Pfam profile PF02301: HORMA domain Length = 1399 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 362 SFFNRCHIWFDTPA---PFFNRYHTQTQKL 282 ++F +CH+WF P+ F NR H +L Sbjct: 760 AYFRQCHLWFPIPSLIISFLNRRHMAFSQL 789 >At4g20730.1 68417.m03013 filament protein-related similar to Cytadherence high molecular weight protein 2 (SP:P47460) [Mycoplasma genitalium]; similar to YEAST NUF1 protein (Spindle poly body spacer protein SPC110) (SP:P32380) {Saccharomyces cerevisiae}; also SP|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal muscle, SP|P31732|OV71_ONCVO Muscle cell intermediate filament protein SP|P12882|MYH1_HUMAN Myosin heavy chain, skeletal muscle,. SP|Q17107|AV71_ACAVI Muscle cell intermediate filament protein Length = 800 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 362 SFFNRCHIWFDTPA---PFFNRYHTQTQKL 282 ++F +CH+WF P+ F NR H +L Sbjct: 169 AYFRQCHLWFPIPSLIISFLNRRHMAFSQL 198 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 157 TVGCVECLAVNSSVFCNFGGLSMNGSWIFC 246 T+ C C + ++V C+ GG S NGS ++C Sbjct: 784 TITC-SCGRITATVPCDAGGRSANGSNVYC 812 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -2 Query: 330 HAGAVLQPVSHADAEARVTDAARVDLAHTEDPGAVH*QAAEVTEHATINS 181 HAG L PV+ A+++AR A ++D E A A+ T+ + S Sbjct: 229 HAGEYLDPVAVAESKARRRRAKKMDSIEDEKAKASEGGKAKNTQQTDVGS 278 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,661,418 Number of Sequences: 28952 Number of extensions: 319788 Number of successful extensions: 756 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -