BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0036 (830 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0214 + 13141213-13143741 28 7.9 02_05_1168 + 34651143-34651424,34651983-34652138,34652239-346523... 28 7.9 >06_02_0214 + 13141213-13143741 Length = 842 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -1 Query: 248 FKSLKKYENARNYIKTNNFVFPLMSPPSDGFLLYFFKFILYQSLGL 111 F + Y+ AR + +++ FP+ LYFF F YQS L Sbjct: 83 FDNSALYQTARIFTSPSSYTFPIQKQGRHFVRLYFFAF-AYQSYDL 127 >02_05_1168 + 34651143-34651424,34651983-34652138,34652239-34652346, 34652778-34652888,34652985-34654421,34654598-34654852 Length = 782 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 468 TTPFRLYLRHVSGVLARQQPQLLSIRSRTKRSPVRTPSRSRLIGNYALYNLSQ 626 T R L + + RQQ +LL+++ R K P + +IG L LS+ Sbjct: 349 TQSLRTELMKMEEKMLRQQQELLALQQRLKEVEREKPVQQDIIGGRLLARLSE 401 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,215,089 Number of Sequences: 37544 Number of extensions: 397340 Number of successful extensions: 823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -