BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0028 (956 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 26 0.38 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.7 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 2.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 4.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 8.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 26.2 bits (55), Expect = 0.38 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 625 VSTAGPSSSPRDGLSCCSETRQDSWHPLHRGQCPRYSTS 509 +S++GP SS G+S R D W G P + S Sbjct: 82 LSSSGPFSSIGGGISASKRQRTDDWLSSPSGNVPPLTPS 120 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 202 PAATVTPSNHWPGHCCCAWPSLRYVADL 285 P T H PG CC P Y +D+ Sbjct: 90 PEPTCDEPVHRPGRCCKTCPGDLYDSDI 117 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.4 bits (48), Expect = 2.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 750 VRVLLRDIGGKACWDASALYFDPSGGQLEGGP 845 V VL+RD GK C + DP Q+ G P Sbjct: 121 VPVLVRD--GKPCLSGGPKHPDPGSLQVPGAP 150 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 648 RFSDSTLASLIELPALDLPARAGTTPG 728 R +T S + ++P AGTTPG Sbjct: 1008 RTHSATSNSSVNANTNNIPTNAGTTPG 1034 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 Query: 863 IVSRITIHWPSFYNVVTWKTL 925 I++ +TI +F++V W+TL Sbjct: 92 ILTTVTIFKSAFWDVDKWRTL 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,887 Number of Sequences: 336 Number of extensions: 4710 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26996013 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -