BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0026 (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14710.1 68418.m01725 expressed protein 29 2.5 At4g29460.1 68417.m04205 phospholipase A2 gamma, secretory low m... 29 2.5 At2g29000.1 68415.m03527 leucine-rich repeat family protein / pr... 29 2.5 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 3.3 At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, put... 29 3.3 At5g64470.2 68418.m08100 expressed protein similar to unknown pr... 27 9.9 At5g64470.1 68418.m08099 expressed protein similar to unknown pr... 27 9.9 At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put... 27 9.9 At1g67325.1 68414.m07663 zinc finger (Ran-binding) family protei... 27 9.9 At1g55580.1 68414.m06361 scarecrow transcription factor family p... 27 9.9 >At5g14710.1 68418.m01725 expressed protein Length = 124 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 604 NKTFLVWCNEEDHLRIISMQMG 539 NKT +V C+ EDH+ II+ Q+G Sbjct: 22 NKTEIVICSYEDHILIIATQIG 43 >At4g29460.1 68417.m04205 phospholipase A2 gamma, secretory low molecular weight identical to secretory low molecular weight phospholipase A2 gamma [Arabidopsis thaliana] GI:26006457; contains INTERPRO domain IPR001211 phospholipase A2 Length = 187 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 520 YKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNL 422 +K+ VN++ K I S+ +++GF T CP ++ Sbjct: 87 HKQFKRCVNKLSKSIKHSNGEKIGFSTQCPYSI 119 >At2g29000.1 68415.m03527 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 872 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -3 Query: 613 HNENKTFLV-WCNEEDHLRII-SMQMGGDLQQ 524 H+ N LV +CNEEDHL ++ GDL+Q Sbjct: 617 HHTNLVNLVGYCNEEDHLALVYEYAANGDLKQ 648 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 533 PAAGVQEAGERRQRDREEDPVLAPRPARLPHVLPDQPGHHGP 408 P A Q+ Q ++ + P P P+ P ++PD P H GP Sbjct: 53 PHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 >At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 856 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 619 IYHNENKTFLVWCNEEDHLRIISMQM-GGDLQQ 524 +YH + + +C+E+DHL +I M GDL++ Sbjct: 606 VYHTNLVSLVGYCDEKDHLALIYQYMVNGDLKK 638 >At5g64470.2 68418.m08100 expressed protein similar to unknown protein (gb|AAD15463.1) Length = 407 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 156 VYLFIVPRRPGTSQRAAPPPLLLFIVKRIFYKE 58 ++ ++ RRP TS A+PPP LF + +F E Sbjct: 35 LFYSLILRRPITSNIASPPPCDLFSGRWVFNPE 67 >At5g64470.1 68418.m08099 expressed protein similar to unknown protein (gb|AAD15463.1) Length = 325 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 156 VYLFIVPRRPGTSQRAAPPPLLLFIVKRIFYKE 58 ++ ++ RRP TS A+PPP LF + +F E Sbjct: 35 LFYSLILRRPITSNIASPPPCDLFSGRWVFNPE 67 >At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 786 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 613 HNENKTFLV-WCNEEDHLRIISMQM-GGDLQQ 524 H++N LV +C+E DHL +I M GDL+Q Sbjct: 531 HHKNLVSLVGYCDEGDHLALIYEYMPNGDLKQ 562 >At1g67325.1 68414.m07663 zinc finger (Ran-binding) family protein similar to ZIS2 [Homo sapiens] GI:4191329; contains Pfam profile PF00641: Zn-finger in Ran binding protein and others Length = 288 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 716 PAAAHRRPLPVQGGRPLHAG 657 PA AH RPL + G P H G Sbjct: 124 PAGAHYRPLHMSGPPPYHGG 143 >At1g55580.1 68414.m06361 scarecrow transcription factor family protein contains Pfam profile PF03514: GRAS family transcription factor Length = 445 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 480 FFSISLTALTSLLYTCCRSPPICIEMMRRWSSSLHHTRNVLFS 608 F S S ++ + T PP+CI +S+ HH R +LF+ Sbjct: 5 FKSSSSSSEDATATTTENPPPLCIASSSAATSASHHLRRLLFT 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,722,114 Number of Sequences: 28952 Number of extensions: 192739 Number of successful extensions: 672 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -