BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0022 (906 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 25 3.2 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 25.0 bits (52), Expect = 3.2 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = -1 Query: 882 SRVILAIDTDSGQKIAKCFL*VGIDRNFVYIIVSNII 772 S ++ + DSG+KIA C + + + + ++++S II Sbjct: 270 SVLVFYLPADSGEKIALC-ISILLSQTMFFLLISEII 305 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,956 Number of Sequences: 2352 Number of extensions: 11867 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -