BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0022 (906 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02630.1 68418.m00199 expressed protein 29 3.2 At5g22600.1 68418.m02640 expressed protein ; expression supporte... 29 4.2 >At5g02630.1 68418.m00199 expressed protein Length = 428 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 662 LIHVPIKLQHNSALCVTESHYV 597 L HV ++LQ N + CV +SHY+ Sbjct: 79 LPHVLLELQQNFSFCVLDSHYI 100 >At5g22600.1 68418.m02640 expressed protein ; expression supported by MPSS Length = 418 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -2 Query: 647 IKLQHNSALCVTESHY---VALCSVIGKLPLLEVTTVMTIVDNLNLL*I-ARDMRSF 489 + L H LC+ + Y ++ S+I P+LE T++ I DN+ +L + ++ + SF Sbjct: 112 VSLPHLKTLCLERNIYPNEASVESLISSCPVLEDLTILRINDNVKVLRVHSQSLTSF 168 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,794,064 Number of Sequences: 28952 Number of extensions: 220963 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -