BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0021 (602 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41530-1|AAA83273.3| 636|Caenorhabditis elegans Hypothetical pr... 32 0.27 DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-t... 31 0.63 AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-t... 31 0.63 AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel... 31 0.63 AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel... 31 0.63 AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel... 31 0.63 U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symme... 29 2.6 U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel t... 29 2.6 DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-t... 29 2.6 AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-t... 29 2.6 AC006701-4|AAK68403.2| 606|Caenorhabditis elegans Hypothetical ... 27 7.8 >U41530-1|AAA83273.3| 636|Caenorhabditis elegans Hypothetical protein SSSD1.1 protein. Length = 636 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 342 SYGAMIEGLGSGGACIGATRSRRACTASHVPDPI 241 SY IE + + G+ T +RR+CT+ H PD + Sbjct: 370 SYRVSIESVNAKGSTNSTTYNRRSCTSLHAPDKL 403 >DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1797 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+PS S Sbjct: 1149 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1182 >AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1831 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+PS S Sbjct: 1183 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1216 >AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform a protein. Length = 1562 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+PS S Sbjct: 1241 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1274 >AF045640-5|AAM81121.1| 1913|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform c protein. Length = 1913 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+PS S Sbjct: 1294 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1327 >AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform d protein. Length = 1861 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+PS S Sbjct: 1213 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSES 1246 >U41994-13|AAK31527.2| 1425|Caenorhabditis elegans Neuronal symmetry protein 1 protein. Length = 1425 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 188 DEMSRFEAEISGGTGRAVIGSGTWDAVQA 274 +E RFE E+S R V+G GT+ V A Sbjct: 652 NEKIRFEYELSNSNERVVLGKGTYGTVYA 680 >U40419-4|AAA81424.3| 1785|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 2 protein. Length = 1785 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+P S Sbjct: 1205 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1238 >DQ917241-1|ABI94564.1| 1763|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1763 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+P S Sbjct: 1183 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1216 >AY555272-1|AAS65872.1| 1785|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1785 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 224 GTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPS 325 GT + W ++ARL+ P+ PP+P S Sbjct: 1205 GTALLTVDQRRWHDLKARLKMAQPLHVPPKPPES 1238 >AC006701-4|AAK68403.2| 606|Caenorhabditis elegans Hypothetical protein Y104H12D.3 protein. Length = 606 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 223 RHWTCSDRIWHMGCRASPSRTGGSNAGPTRT 315 RH ++ W GC A+P+ +GG + G T Sbjct: 368 RHQFFTNSEWPGGCYATPTMSGGRDGGAVAT 398 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,207,216 Number of Sequences: 27780 Number of extensions: 239996 Number of successful extensions: 805 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -