BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0019 (837 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58250.1 68416.m06494 meprin and TRAF homology domain-contain... 31 0.95 At1g43245.1 68414.m04985 expressed protein 29 2.9 At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR... 29 5.1 At3g22980.1 68416.m02898 elongation factor Tu family protein sim... 29 5.1 At2g42180.1 68415.m05220 expressed protein 28 8.8 At2g12130.1 68415.m01306 hypothetical protein 28 8.8 >At3g58250.1 68416.m06494 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 317 Score = 31.1 bits (67), Expect = 0.95 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +1 Query: 157 KQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVNWSGKEFLRETWTRFVE 336 K + L + + D F+ G +L F + K D + L ++ + E L W R + Sbjct: 16 KNFSSLQSEKIYSDQFVIDGCRWRLLAFPKGNDTKSDHLSLYLDVAESESLPCGWRRHAQ 75 Query: 337 DSFPIVN 357 SF IVN Sbjct: 76 FSFTIVN 82 >At1g43245.1 68414.m04985 expressed protein Length = 558 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 361 QEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVGMN 516 QE +D +L N+ P + + H ++++ED PH +R+ YV +N Sbjct: 321 QEAIDDFLSDNIDPKTCCEMIESVLHHGIQFKEDSQPH-CLRLHACHYVALN 371 >At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1231 Score = 28.7 bits (61), Expect = 5.1 Identities = 21/80 (26%), Positives = 36/80 (45%) Frame = +1 Query: 88 KNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPD 267 KNL I+N++ ++ E W L + + E G G N+KL + +K D Sbjct: 54 KNLFKRIENSEIALAVLSSRYTESHWCLQELVKMMECSMKGEGCNKKLLVIPIFYKLKID 113 Query: 268 TMKLIVNWSGKEFLRETWTR 327 T+K + G+ L + W + Sbjct: 114 TVKELDGDFGRN-LWDLWRK 132 >At3g22980.1 68416.m02898 elongation factor Tu family protein similar to eukaryotic translation elongation factor 2 GB:NP_001952 [Homo sapiens] Length = 1015 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 184 MVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVN 288 M+ EDPF P +++ F + SV P+T + ++N Sbjct: 953 MLEEDPFFVPKTEEEIEEFGDGASVLPNTARKLIN 987 >At2g42180.1 68415.m05220 expressed protein Length = 166 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -1 Query: 834 TIVCKSTTHRI*RLINVLITMYSVLIRRTSEQRRVWCKLLYFENERNLN*DFLFFG 667 T+ TH + RL+ L SVLI + ++ ++++ + ++N +FFG Sbjct: 17 TLFINLITHSLYRLLRSLSRARSVLIEISKHNKKRLFMMMFYTTKSSMNQHNIFFG 72 >At2g12130.1 68415.m01306 hypothetical protein Length = 209 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 406 VWV*GWRRGTRPSPLGRLQWGSCPQQNGSKFHAKTLC 296 +W WR P LGR +G+C + ++A+ LC Sbjct: 170 LWNRSWRFVVSPDCLGRCSYGACCRNCFFYWYARELC 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,767,699 Number of Sequences: 28952 Number of extensions: 411326 Number of successful extensions: 1180 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -