BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0018 (929 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 28 0.090 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 1.1 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 23 3.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 3.4 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 4.5 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 28.3 bits (60), Expect = 0.090 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = +1 Query: 466 TYRMFCSGDLGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVSVCKVLSACS 636 TY C S S+L P K P TP RAK+ +K ++V + ACS Sbjct: 222 TYTSICIEIWQSSESSLRPRSSQKSAPGKRTPLISRAKIN-TVKQTIAVIVMYIACS 277 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 272 IENQSTSTYNCTIDNLSTLSRSVRF-RLISTRTRKR 168 + N+ + YN I+NL T + F L+ T++R Sbjct: 428 LNNEGSLVYNVQIENLKTTPDNTTFITLVDVSTKRR 463 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 423 YSNIDCSKSFTKIINIS 473 Y IDC+KSF++ N++ Sbjct: 22 YRCIDCNKSFSQAANLT 38 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 423 YSNIDCSKSFTKIINIS 473 Y IDC+KSF++ N++ Sbjct: 278 YRCIDCNKSFSQAANLT 294 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +1 Query: 175 LVRVEIKRNRTDLERVDRLSIVQLYVLVDWFSML 276 LV + + N T + + + + QL+ LV W ++ Sbjct: 199 LVALVVNENNTTVNNICQATHKQLFQLVQWAKLV 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,643 Number of Sequences: 336 Number of extensions: 5206 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26065116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -