BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0018 (929 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0674 - 24187820-24188713,24188809-24189204 31 1.7 12_01_0461 + 3618414-3618782,3619664-3619794,3620177-3620294,362... 29 7.0 >01_05_0674 - 24187820-24188713,24188809-24189204 Length = 429 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 500 PPPATSYLWAKSNKSRISTRH 562 PPPA S+ WAK +SR +T H Sbjct: 170 PPPAPSHQWAKIKRSRHATDH 190 >12_01_0461 + 3618414-3618782,3619664-3619794,3620177-3620294, 3620602-3620654,3620758-3620807,3620912-3621010, 3621511-3621620,3621773-3621900,3622071-3622161, 3622610-3622693,3622863-3623083,3623449-3623527, 3624134-3624283,3624326-3624470,3624604-3624983, 3625096-3625197 Length = 769 Score = 28.7 bits (61), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 493 LGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVSVCKVLSACSYFHTQ 651 +GP S ++ L ++ DL P L P L V C++ ++ YF Q Sbjct: 430 IGPHSEYMVKLHRLPWALDLGHPGHGPGGLGPGLSAPVGECRLDASWPYFFVQ 482 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,111,169 Number of Sequences: 37544 Number of extensions: 533325 Number of successful extensions: 1062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -