BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0018 (929 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125443-3|AAD12799.2| 414|Caenorhabditis elegans Hypothetical ... 31 1.6 >AF125443-3|AAD12799.2| 414|Caenorhabditis elegans Hypothetical protein H32C10.1 protein. Length = 414 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -3 Query: 927 MGPPGAGSISA*CIFFYLGFFKCLGPDHIVQWVFAHNIC 811 +G A +I+ IFF +GF K DH+V+W F H C Sbjct: 111 VGQKNARAIAKGIIFFRVGFKKVTTIDHLVKW-FPHLDC 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,395,589 Number of Sequences: 27780 Number of extensions: 475144 Number of successful extensions: 1026 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2391724104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -