Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF125443-3|AAD12799.2|  414|Caenorhabditis elegans Hypothetical ...    31   1.6  

>AF125443-3|AAD12799.2|  414|Caenorhabditis elegans Hypothetical
           protein H32C10.1 protein.
          Length = 414

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = -3

Query: 927 MGPPGAGSISA*CIFFYLGFFKCLGPDHIVQWVFAHNIC 811
           +G   A +I+   IFF +GF K    DH+V+W F H  C
Sbjct: 111 VGQKNARAIAKGIIFFRVGFKKVTTIDHLVKW-FPHLDC 148


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,395,589
Number of Sequences: 27780
Number of extensions: 475144
Number of successful extensions: 1026
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 985
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1026
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2391724104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)