BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0006 (852 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI107... 38 0.32 UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2; ... 36 1.3 UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI011... 34 5.2 >UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI1070c; n=4; Plasmodium|Rep: Putative uncharacterized protein PFI1070c - Plasmodium falciparum (isolate 3D7) Length = 395 Score = 37.9 bits (84), Expect = 0.32 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = -1 Query: 249 HFNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSK 136 H+ + + H IY+ +++++ L +FFF+RYN ++ K Sbjct: 272 HYKSYHTHTHIYIYIYIYIYILYMRIFFFYRYNFVDKK 309 >UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2; Flavobacteriales|Rep: Putative uncharacterized protein - Robiginitalea biformata HTCC2501 Length = 382 Score = 35.9 bits (79), Expect = 1.3 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = -1 Query: 474 TPLFLVF-FFLNTIAVSIVANRKNKATDTAHEHRRLILRT*E*IVALGFF 328 TP LVF FFL + SIV +NK D A HR++I+RT + ++ LG F Sbjct: 64 TPTDLVFPFFLFIVGTSIVFAYRNKQPDAA-THRKIIVRTLK-LILLGIF 111 >UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 195 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 222 FIYLSNFLFLFYLINIVFFFF 160 FIY NF+ LF ++NI+FFFF Sbjct: 6 FIYYHNFILLFLVLNILFFFF 26 >UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI0110c; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFI0110c - Plasmodium falciparum (isolate 3D7) Length = 608 Score = 33.9 bits (74), Expect = 5.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 246 FNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSKC 133 +NN Y LF+ L F+ +I++ FFF I +KC Sbjct: 14 YNNKYIGLFLNLKGFVMYLLVISLYFFFLFLTEIQNKC 51 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,068,600 Number of Sequences: 1657284 Number of extensions: 13318349 Number of successful extensions: 31333 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31035 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 75013275813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -