BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0002 (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 77 3e-13 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.004 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 39 0.10 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 36 1.3 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 34 2.9 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 77.4 bits (182), Expect = 3e-13 Identities = 42/74 (56%), Positives = 46/74 (62%) Frame = +1 Query: 412 GAPTARRTNATXSFLTATILVYXXXXXXXXXXXXRLALQLFLVKIFKVYSFRLRGLVRVP 591 G P AR + T SFLTA L+Y RLALQ LVK FKV SF+L+GL RV Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVL 89 Query: 592 YRYFSSLPPRAGSG 633 Y YFSSLPPR GSG Sbjct: 90 YCYFSSLPPRVGSG 103 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 70 GKCFR*CSSCDDPRISPLTSQYECPQ 147 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.1 bits (87), Expect = 0.10 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 576 PRKSPVSIFFVTTSPCREW 632 PRKSPV +FFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 35.5 bits (78), Expect = 1.3 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 61 FHQSRTKVRGSKAIRYRPSS 2 F RTKVRGSK IRYRPSS Sbjct: 6 FRCQRTKVRGSKTIRYRPSS 25 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.3 bits (75), Expect = 2.9 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 486 SWNYRGCWHQTCP 524 SWNYR CWHQT P Sbjct: 7 SWNYRSCWHQTGP 19 Score = 32.7 bits (71), Expect = 8.9 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +1 Query: 613 PPRAGSG*FARLLPS*DVVAVSQAPS 690 PP+ SG +RLL D+VA+SQAPS Sbjct: 46 PPKVSSGKVSRLLLPVDIVAISQAPS 71 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,620,430 Number of Sequences: 1657284 Number of extensions: 12807988 Number of successful extensions: 28200 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28196 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -