BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cesb0002 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142... 28 8.2 01_05_0005 - 16886553-16886946,16887079-16887404 28 8.2 >04_04_1500 + 34010819-34011016,34013267-34013308,34014195-34014204, 34014526-34014586,34014621-34014678,34015266-34015412, 34015643-34016205,34018942-34019728 Length = 621 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 626 PARGGSDEKYRYGTLTRPRNRNEYTLNI--LTRNNWRAS 516 P RGG +KY G +RP + + L R NW A+ Sbjct: 197 PTRGGGGKKYAIGYRSRPEKSKKRIASFMKLLRFNWAAA 235 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 459 RNNFSIRYWSWNYRGC 506 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,040,218 Number of Sequences: 37544 Number of extensions: 356369 Number of successful extensions: 725 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -