SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-6278
         (383 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    21   4.9  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    20   8.6  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    20   8.6  

>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 21.0 bits (42), Expect = 4.9
 Identities = 11/41 (26%), Positives = 25/41 (60%)
 Frame = -1

Query: 215 REAVMRFGLKGGAAVVTILEILELIPQDGWRICVVDVNGLQ 93
           R+  +  G   GAA++  L+I + IP++  R+ ++  +G++
Sbjct: 298 RQEGLLCGGSSGAALIAALKIAKDIPEEK-RMVIILPDGIR 337


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.2 bits (40), Expect = 8.6
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 120 NAPPILRYKF 149
           NAPP+L Y F
Sbjct: 419 NAPPMLLYSF 428


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.2 bits (40), Expect = 8.6
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 120 NAPPILRYKF 149
           NAPP+L Y F
Sbjct: 419 NAPPMLLYSF 428


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,505
Number of Sequences: 438
Number of extensions: 2395
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9424380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -