BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-6260
(310 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_04_0510 + 23558111-23559613 29 0.98
12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045 25 9.2
>02_04_0510 + 23558111-23559613
Length = 500
Score = 28.7 bits (61), Expect = 0.98
Identities = 13/38 (34%), Positives = 18/38 (47%)
Frame = +1
Query: 91 KHGSGFHSALAFRTPRPIRRVQHAHLPRITHIKVFCYF 204
K G F ++ FR P+ V H T I +FCY+
Sbjct: 336 KSGHLFEASQVFRVEMPMNGVSHNLATYNTMISIFCYY 373
>12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045
Length = 1294
Score = 25.4 bits (53), Expect = 9.2
Identities = 8/13 (61%), Positives = 10/13 (76%)
Frame = +1
Query: 163 HLPRITHIKVFCY 201
HLP+I H+K CY
Sbjct: 648 HLPKIAHLKHLCY 660
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,247,104
Number of Sequences: 37544
Number of extensions: 71435
Number of successful extensions: 151
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 151
length of database: 14,793,348
effective HSP length: 71
effective length of database: 12,127,724
effective search space used: 375959444
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -