Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-6260
         (310 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0510 + 23558111-23559613                                         29   0.98 
12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045           25   9.2  

>02_04_0510 + 23558111-23559613
          Length = 500

 Score = 28.7 bits (61), Expect = 0.98
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = +1

Query: 91  KHGSGFHSALAFRTPRPIRRVQHAHLPRITHIKVFCYF 204
           K G  F ++  FR   P+  V H      T I +FCY+
Sbjct: 336 KSGHLFEASQVFRVEMPMNGVSHNLATYNTMISIFCYY 373


>12_01_0638 - 5376164-5376247,5376734-5380517,5382029-5382045
          Length = 1294

 Score = 25.4 bits (53), Expect = 9.2
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 163 HLPRITHIKVFCY 201
           HLP+I H+K  CY
Sbjct: 648 HLPKIAHLKHLCY 660


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,247,104
Number of Sequences: 37544
Number of extensions: 71435
Number of successful extensions: 151
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 151
length of database: 14,793,348
effective HSP length: 71
effective length of database: 12,127,724
effective search space used: 375959444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)