Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-6238
         (745 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF068709-11|AAC19247.1|  106|Caenorhabditis elegans Downstream o...    30   1.5  

>AF068709-11|AAC19247.1|  106|Caenorhabditis elegans Downstream of
           daf-16 (regulatedby daf-16) protein 3 protein.
          Length = 106

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
 Frame = +1

Query: 13  VSLVVGPLVSPHGYVPPAKNQKKKKLAGQLDLSAPQLKFKSY-EQHPAAQPTL-PN*AVK 186
           + +   P+V+P  Y+ PA  Q KKK A     S  Q+K  +Y    P AQ  + PN  V 
Sbjct: 7   IDIESAPIVTPPPYMDPANAQAKKKWARVRQESCSQMKPCAYCGAAPEAQKAMFPNEPVF 66

Query: 187 NYESSR 204
            + + R
Sbjct: 67  MWPAQR 72


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,588,911
Number of Sequences: 27780
Number of extensions: 345082
Number of successful extensions: 900
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 875
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 900
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1756472266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)