Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-6108
         (764 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|c...    27   2.9  
SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|...    25   9.0  

>SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 197

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 118 NIDRCRYFKNLHNTIYSSLQRLPKALNTSL 29
           N++R + FK+LH  IYS L+ L   L  S+
Sbjct: 70  NVERRQEFKDLHPNIYSLLRLLIAVLAVSV 99


>SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 329

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +1

Query: 724 VYIISTGSINYWT 762
           VY++  GS+NYWT
Sbjct: 225 VYLLLFGSVNYWT 237


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,875,819
Number of Sequences: 5004
Number of extensions: 54676
Number of successful extensions: 115
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 115
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 367316502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)